• Gene id: 283149

Gene Summary

• Gene Symbol: BCL9L   Gene   UCSC   Ensembl
• Aliases: B9L, BCL9-2, DLNB11
• Gene name: BCL9 like
• Alternate names: B-cell CLL/lymphoma 9-like protein, B cell CLL/lymphoma 9 like, B-cell lymphoma 9-like protein, BCL9-like protein, nuclear co-factor of beta-catenin signalling, protein BCL9-2,
• Gene location: 11q23.3 (118926070: 118896135)     Exons: 13     NC_000011.10
• OMIM: 609004

Protein Summary

• Protein general information: Q86UU0  
  • Name: B cell CLL/lymphoma 9 like protein (B cell lymphoma 9 like protein) (BCL9 like protein) (Protein BCL9 2)
  • Length: 1499  
  • Mass: 157129
  • Tissue specificity: Expressed in breast, ductal and invasive ductal carcinomas of the breast, sporadic colorectal adenomas and carcinomas (at protein level). Expressed in fetal brain. Expressed in lung, amygdala, eye, prostate, pancreatic and prostate can
• Sequence:

  MRILANKTRLPHPRRREAPGSPPLSPRGHCPPAPAKPMHPENKLTNHGKTGNGGAQSQHQNVNQGPTCNVGSKGV
  GAGNHGAKANQISPSNSSLKNPQAGVPPFSSLKGKVKRDRSVSVDSGEQREAGTPSLDSEAKEVAPRSKRRCVLE
  RKQPYSGDEWCSGPDSEEDDKPIGATHNCNVADPAMAAPQLGPGQTTQLPLSESSVPGAPHGPPPGLRPDAPGGG
  GGGGGVPGKPPSQFVYVFTTHLANTAAEAVLQGRADSILAYHQQNVPRAKLDQAPKVPPTPEPLPLSTPSAGTPQ
  SQPPPLPPPPPPAPGSAPPALPPEGPPEDSSQDLAPNSVGAASTGGGTGGTHPNTPTATTANNPLPPGGDPSSAP
  GPALLGEAAAPGNGQRSLVGSEGLSKEQLEHRERSLQTLRDIERLLLRSGETEPFLKGPPGGAGEGGPPAQAPPP
  PQQPPTAPPSGLKKYEEPLQSMISQTQSLGGPPLEHEVPGHPPGGDMGQQMNMMIQRLGQDSLTPEQVAWRKLQE
  EYYEEKRRKEEQIGLHGSRPLQDMMGMGGMMVRGPPPPYHSKPGDQWPPGMGAQLRGPMDVQDPMQLRGGPPFPG
  PRFPGNQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPPMGGPSNFAQNTMPYPGGQGEAERFMTPRVR
  EELLRHQLLEKRSMGMQRPLGMAGSGMGQSMEMERMMQAHRQMDPAMFPGQMAGGEGLAGTPMGMEFGGGRGLLS
  PPMGQSGLREVDPPMGPGNLNMNMNVNMNMNMNLNVQMTPQQQMLMSQKMRGPGDLMGPQGLSPEEMARVRAQNS
  SGVMGGPQKMLMPSQFPNQGQQGFSGGQGPYQAMSQDMGNTQDMFSPDQSSMPMSNVGTTRLSHMPLPPASNPPG
  TVHSAPNRGLGRRPSDLTISINQMGSPGMGHLKSPTLSQVHSPLVTSPSANLKSPQTPSQMVPLPSANPPGPLKS
  PQVLGSSLSVRSPTGSPSRLKSPSMAVPSPGWVASPKTAMPSPGVSQNKQPPLNMNSSTTLSNMEQGTLPPSGPR
  SSSSAPPANPPSGLMNPSLPFTSSPDPTPSQNPLSLMMTQMSKYAMPSSTPLYHNAIKTIATSDDELLPDRPLLP
  PPPPPQGSGPGISNSQPSQMHLNSAAAQSPMGMNLPGQQPLSHEPPPAMLPSPTPLGSNIPLHPNAQGTGGPPQN
  SMMMAPGGPDSLNAPCGPVPSSSQMMPFPPRLQQPHGAMAPTGGGGGGPGLQQHYPSGMALPPEDLPNQPPGPMP
  PQQHLMGKAMAGRMGDAYPPGVLPGVASVLNDPELSEVIRPTPTGIPEFDLSRIIPSEKPSSTLQYFPKSENQPP
  KAQPPNLHLMNLQNMMAEQTPSRPPNLPGQQGVQRGLNMSMCHPGQMSLLGRTGVPPQQGMVPHGLHQGVMSPPQ
  GLMTQQNFMLMKQRGVGGEVYSQPPHMLSPQGSLMGPPPQQNLMVSHPLRQRSVSLDSQMGYLPAPGGMANLPF

• Structural information:
  • Interpro: IPR015668  IPR024670  IPR013083  
  • PDB: 2XB1 4UP0 4UP5
  • PDBsum: 2XB1 4UP0 4UP5
  • STRING: ENSP00000335320
• Other Databases: GeneCards:  BCL9L  Malacards:  BCL9L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008013	beta-catenin binding	IBA	molecular function
GO:1990907	beta-catenin-TCF complex	IBA	cellular component
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:1990907	beta-catenin-TCF complex	IDA	cellular component
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0003713	transcription coactivator activity	NAS	molecular function
GO:0005634	nucleus	IC	cellular component
GO:0010718	positive regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0022604	regulation of cell morphogenesis	IMP	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881