• Gene id: 283

Gene Summary

• Gene Symbol: ANG   Gene   UCSC   Ensembl
• Aliases: ALS9, HEL168, RAA1, RNASE4, RNASE5
• Gene name: angiogenin
• Alternate names: angiogenin, RNase 5, angiogenin, ribonuclease, RNase A family, 5, epididymis luminal protein 168, ribonuclease 5, ribonuclease A A1, ribonuclease A family member 5,
• Gene location: 14q11.2 (20684176: 20694185)     Exons: 3     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is an exceedingly potent mediator of new blood vessel formation. It hydrolyzes cellular tRNAs resulting in decreased protein synthesis and is similar to pancreatic ribonuclease. In addition, the mature peptide has antimicr
• OMIM: 602238

SNPs

rs868256749

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.63617303C>T
NC_000012.11   g.64011083C>T
NG_031909.1   g.56272G>A|SEQ=[C/T]|GENE=DPY19L2

rs751879424

Strand:    Allele origin:   Allele change:   Mutation type: del

NC_000012.12   g.63617339del
NC_000012.11   g.64011119del
NG_031909.1   g.56236del
NM_173812.4   c.1183del
NM_173812.5   c.1183del
XM_011538218.3   c.172del
XR_001748666.2   n.1335del
XM_006719352.2   c.754del
XM_017019192.2   c.1033del
XM_017019203.2   c.238del
XM_0170  

rs587777206

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.63624101G>A
NC_000012.11   g.64017881G>A
NG_031909.1   g.49474C>T
NM_173812.4   c.892C>T
NM_173812.5   c.892C>T
XR_001748666.2   n.1044C>T
XM_006719352.2   c.463C>T
XM_017019193.2   c.589C>T
XM_011538215.2   c.379C>T
XR_002957317.1   n.1044C>T
XR_002957  

rs587777205

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.63569312T>A
NC_000012.12   g.63569312T>G
NC_000012.11   g.63963092T>A
NC_000012.11   g.63963092T>G
NG_031909.1   g.104263A>T
NG_031909.1   g.104263A>C
NM_173812.4   c.2038A>T
NM_173812.4   c.2038A>C
NM_173812.5   c.2038A>T
NM_173812.5   c.2038A>C
XM_011  

rs147579680

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.63624124C>T
NC_000012.11   g.64017904C>T
NG_031909.1   g.49451G>A
NM_173812.4   c.869G>A
NM_173812.5   c.869G>A
XR_001748666.2   n.1021G>A
XM_006719352.2   c.440G>A
XM_017019193.2   c.566G>A
XM_011538215.2   c.356G>A
XR_002957317.1   n.1021G>A
XR_002957  

rs7354779

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000021.9   g.44250887T>C
NC_000021.8   g.45670770T>C
NM_013369.3   c.832A>G
NM_013369.4   c.832A>G
NM_175867.2   c.832A>G
NM_175867.3   c.832A>G
NR_135514.1   n.75T>C
NP_037501.2   p.Arg278Gly
NP_787063.1   p.Arg278Gly|SEQ=[T/C]|GENE=DNMT3L
DNMT3L-AS1   1053728

rs3021522

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.2799979C>G
NC_000012.11   g.2909145C>G|SEQ=[C/G]|GENE=FKBP4
ITFG2-AS1   283440

Protein Summary

• Protein general information: P03950  
  • Name: Angiogenin (EC 3.1.27. ) (Ribonuclease 5) (RNase 5)
  • Length: 147  
  • Mass: 16550
  • Tissue specificity: Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons. {ECO
• Sequence:

  MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKR
  SIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP

• Structural information:
  • Interpro: IPR001427  IPR036816  IPR023411  IPR023412  
  • Prosite: PS00127
  • PDB: 1A4Y 1ANG 1AWZ 1B1E 1B1I 1B1J 1GV7 1H0D 1H52 1H53 1HBY 1K58 1K59 1K5A 1K5B 1UN3 1UN4 1UN5 2ANG 4AHD 4AHE 4AHF 4AHG 4AHH 4AHI 4AHJ 4AHK 4AHL 4AHM 4AHN 4AOH 4B36 5EOP 5EPZ 5EQO 5M9A 5M9C 5M9G 5M9J 5M9M 5M9P 5M9Q 5M9R 5M9S 5M9T 5M9V
  • PDBsum: 1A4Y 1ANG 1AWZ 1B1E 1B1I 1B1J 1GV7 1H0D 1H52 1H53 1HBY 1K58 1K59 1K5A 1K5B 1UN3 1UN4 1UN5 2ANG 4AHD 4AHE 4AHF 4AHG 4AHH 4AHI 4AHJ 4AHK 4AHL 4AHM 4AHN 4AOH 4B36 5EOP 5EPZ 5EQO 5M9A 5M9C 5M9G 5M9J 5M9M 5M9P 5M9Q 5M9R 5M9S 5M9T 5M9V
  • STRING: ENSP00000336762
• Other Databases: GeneCards:  ANG  Malacards:  ANG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004540	ribonuclease activity	IBA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0017148	negative regulation of translation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0032311	angiogenin-PRI complex	IDA	cellular component
GO:0001525	angiogenesis	IDA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005604	basement membrane	IDA	cellular component
GO:0005507	copper ion binding	IDA	molecular function
GO:0001666	response to hypoxia	IDA	biological process
GO:0001666	response to hypoxia	IDA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0003779	actin binding	IDA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0001666	response to hypoxia	IDA	biological process
GO:0050714	positive regulation of protein secretion	IDA	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0042277	peptide binding	IDA	molecular function
GO:0009725	response to hormone	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0006651	diacylglycerol biosynthetic process	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IC	molecular function
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0042592	homeostatic process	NAS	biological process
GO:0032311	angiogenin-PRI complex	IPI	cellular component
GO:0016477	cell migration	IMP	biological process
GO:0007154	cell communication	NAS	biological process
GO:0001666	response to hypoxia	NAS	biological process
GO:0001556	oocyte maturation	NAS	biological process
GO:0001541	ovarian follicle development	NAS	biological process
GO:0050714	positive regulation of protein secretion	ISS	biological process
GO:0032148	activation of protein kinase B activity	IMP	biological process
GO:0030426	growth cone	ISS	cellular component
GO:0009303	rRNA transcription	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032431	activation of phospholipase A2 activity	IMP	biological process
GO:0030041	actin filament polymerization	ISS	biological process
GO:0019843	rRNA binding	TAS	molecular function
GO:0007202	activation of phospholipase C activity	IMP	biological process
GO:0005730	nucleolus	ISS	cellular component
GO:0004519	endonuclease activity	TAS	molecular function
GO:0001890	placenta development	NAS	biological process
GO:0001525	angiogenesis	IMP	biological process
GO:0001525	angiogenesis	IMP	biological process
GO:0001525	angiogenesis	TAS	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Amyotrophic lateral sclerosis	KEGG:H00058
Amyotrophic lateral sclerosis	KEGG:H00058
Inflammatory bowel disease	PMID:20629092
Ductal carcinoma in situ	PMID:15776477
Prostate cancer	PMID:11948474
Prostate cancer	PMID:19276260
Alzheimer's disease	PMID:22449478
urinary bladder cancer	PMID:15912517
Endometrial cancer	PMID:9119882
Parkinson's disease	PMID:22190368
pancreatic cancer	PMID:8665497
Ovarian cancer	PMID:9166545
Asthma	PMID:16478840
Endometriosis	PMID:14748845
Chronic obstructive pulmonary disease	PMID:21916917
Amyotrophic lateral sclerosis	PMID:19177252
Amyotrophic lateral sclerosis	PMID:22190368
Cerebral infarction	PMID:17823536
Trophoblastic neoplasm	PMID:12705339
cervical cancer	PMID:11299848
renal cell carcinoma	PMID:18808740
Myocardial infarction	PMID:18462761
Rheumatoid arthritis	PMID:12653852
Diabetic retinopathy	PMID:18978347
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray