• Gene id: 282969

Gene Summary

• Gene Symbol: FUOM   Gene   UCSC   Ensembl
• Aliases: C10orf125, FUCU, FucM
• Gene name: fucose mutarotase
• Alternate names: fucose mutarotase, protein fucU homolog,
• Gene location: 10q26.3 (87590066: 87677823)     Exons: 24     NC_000006.12
• OMIM: 617725

Protein Summary

• Protein general information: A2VDF0  
  • Name: Fucose mutarotase (EC 5.1.3.29)
  • Length: 154  
  • Mass: 16765
• Sequence:

  MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESP
  AAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGETALYGNLILRKGVLAL
  NPLL

• Structural information:
  • Interpro: IPR023750  IPR007721  
  • STRING: ENSP00000278025
• Other Databases: GeneCards:  FUOM  Malacards:  FUOM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006004	fucose metabolic process	IBA	biological process
GO:0036065	fucosylation	IBA	biological process
GO:0042806	fucose binding	IBA	molecular function
GO:0016857	racemase and epimerase activity, acting on carbohydrates and derivatives	IBA	molecular function
GO:0016857	racemase and epimerase activity, acting on carbohydrates and derivatives	ISS	molecular function
GO:0042806	fucose binding	ISS	molecular function
GO:0006004	fucose metabolic process	ISS	biological process
GO:0036373	L-fucose mutarotase activity	ISS	molecular function
GO:0005996	monosaccharide metabolic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0048029	monosaccharide binding	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0036373	L-fucose mutarotase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006004	fucose metabolic process	IEA	biological process
GO:0036065	fucosylation	IEA	biological process
GO:0036373	L-fucose mutarotase activity	IEA	molecular function
GO:0042806	fucose binding	IEA	molecular function
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0016857	racemase and epimerase activity, acting on carbohydrates and derivatives	IEA	molecular function
GO:0060180	female mating behavior	IEA	biological process
GO:0006004	fucose metabolic process	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq