• Gene id: 2828

Gene Summary

• Gene Symbol: GPR4   Gene   UCSC   Ensembl
• Gene name: G protein-coupled receptor 4
• Alternate names: G-protein coupled receptor 4, G-protein coupled receptor 19,
• Gene location: 19q13.32 (45602211: 45589763)     Exons: 9     NC_000019.10
• OMIM: 600551

Protein Summary

• Protein general information: P46093  
  • Name: G protein coupled receptor 4 (G protein coupled receptor 19)
  • Length: 362  
  • Mass: 40982
• Sequence:

  MGNHTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLSIADLLYICTLPLWVD
  YFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANS
  APLFHDELFRDRYNHTFCFEKFPMEGWVAWMNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKAKIKRL
  ALSLIAIVLVCFAPYHVLLLSRSAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKA
  LHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQGDQVQLKMLPPAQ

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR002276  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000319744
• Other Databases: GeneCards:  GPR4  Malacards:  GPR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0035025	positive regulation of Rho protein signal transduction	IBA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	biological process
GO:0010447	response to acidic pH	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0030155	regulation of cell adhesion	IDA	biological process
GO:0010447	response to acidic pH	IDA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IMP	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0043114	regulation of vascular permeability	ISS	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IMP	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IMP	biological process
GO:0010447	response to acidic pH	IMP	biological process
GO:0004930	G protein-coupled receptor activity	IMP	molecular function
GO:0035025	positive regulation of Rho protein signal transduction	IMP	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0010447	response to acidic pH	IEA	biological process
GO:0072144	glomerular mesangial cell development	IEA	biological process
GO:0060055	angiogenesis involved in wound healing	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)