• Gene id: 282679

Gene Summary

• Gene Symbol: AQP11   Gene   UCSC   Ensembl
• Aliases: AQPX1
• Gene name: aquaporin 11
• Alternate names: aquaporin-11, AQP-11,
• Gene location: 11q14.1 (77899467: 77907375)     Exons: 3     NC_000023.11
• OMIM: 609914

Protein Summary

• Protein general information: Q8NBQ7  
  • Name: Aquaporin 11 (AQP 11)
  • Length: 271  
  • Mass: 30203
  • Tissue specificity: Detected in the sperm head and tail (at protein level) (PubMed
• Sequence:

  MSPLLGLRSELQDTCTSLGLMLSVVLLMGLARVVARQQLHRPVAHAFVLEFLATFQLCCCTHELQLLSEQHPAHP
  TWTLTLVYFFSLVHGLTLVGTSSNPCGVMMQMMLGGMSPETGAVRLLAQLVSALCSRYCTSALWSLGLTQYHVSE
  RSFACKNPIRVDLLKAVITEAVCSFLFHSALLHFQEVRTKLRIHLLAALITFLVYAGGSLTGAVFNPALALSLHF
  MCFDEAFPQFFIVYWLAPSLGILLMILMFSFFLPWLHNNHTINKKE

• Structural information:
  • Interpro: IPR023271  IPR023266  IPR016697  IPR000425  
  • STRING: ENSP00000318770
• Other Databases: GeneCards:  AQP11  Malacards:  AQP11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0015267	channel activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0015250	water channel activity	IDA	molecular function
GO:0030104	water homeostasis	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0051260	protein homooligomerization	IDA	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0030104	water homeostasis	IMP	biological process
GO:0015250	water channel activity	IMP	molecular function
GO:0015254	glycerol channel activity	IMP	molecular function
GO:0015793	glycerol transport	IMP	biological process
GO:0015250	water channel activity	ISS	molecular function
GO:0050680	negative regulation of epithelial cell proliferation	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0033577	protein glycosylation in endoplasmic reticulum	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0009992	cellular water homeostasis	ISS	biological process
GO:0080170	hydrogen peroxide transmembrane transport	IMP	biological process
GO:0006833	water transport	IMP	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0051260	protein homooligomerization	ISS	biological process
GO:0009992	cellular water homeostasis	ISS	biological process
GO:1904293	negative regulation of ERAD pathway	ISS	biological process
GO:1903573	negative regulation of response to endoplasmic reticulum stress	ISS	biological process
GO:0072014	proximal tubule development	ISS	biological process
GO:0006612	protein targeting to membrane	ISS	biological process
GO:0015267	channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0033577	protein glycosylation in endoplasmic reticulum	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0001822	kidney development	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:1904293	negative regulation of ERAD pathway	IEA	biological process
GO:1903573	negative regulation of response to endoplasmic reticulum stress	IEA	biological process
GO:0072014	proximal tubule development	IEA	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0048388	endosomal lumen acidification	IEA	biological process
GO:0032364	oxygen homeostasis	IEA	biological process
GO:0009992	cellular water homeostasis	IEA	biological process
GO:0006612	protein targeting to membrane	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0006833	water transport	IDA	NOT|biological process
GO:0006811	ion transport	IDA	NOT|biological process
GO:0015840	urea transport	IDA	NOT|biological process
GO:0015793	glycerol transport	IDA	NOT|biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881