• Gene id: 282618

Gene Summary

• Gene Symbol: IFNL1   Gene   UCSC   Ensembl
• Aliases: IL-29, IL29
• Gene name: interferon lambda 1
• Alternate names: interferon lambda-1, IFN-lambda-1, cytokine Zcyto21, interleukin 29 (interferon, lambda 1), interleukin-29,
• Gene location: 19q13.2 (39296406: 39298672)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region m
• OMIM: 607403

Protein Summary

• Protein general information: Q8IU54  
  • Name: Interferon lambda 1 (IFN lambda 1) (Cytokine Zcyto21) (Interleukin 29) (IL 29)
  • Length: 200  
  • Mass: 21898
• Sequence:

  MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPG
  NWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWL
  HRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

• Structural information:
  • Interpro: IPR038326  IPR029177  
  • PDB: 3OG4 3OG6
  • PDBsum: 3OG4 3OG6
  • STRING: ENSP00000329991
• Other Databases: GeneCards:  IFNL1  Malacards:  IFNL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0050778	positive regulation of immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT	IDA	biological process
GO:0032729	positive regulation of interferon-gamma production	IDA	biological process
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0032714	negative regulation of interleukin-5 production	IDA	biological process
GO:0032696	negative regulation of interleukin-13 production	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045581	negative regulation of T cell differentiation	IDA	biological process
GO:0045345	positive regulation of MHC class I biosynthetic process	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0043381	negative regulation of memory T cell differentiation	IDA	biological process
GO:0032002	interleukin-28 receptor complex	IDA	cellular component
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0002829	negative regulation of type 2 immune response	IDA	biological process
GO:0032003	interleukin-28 receptor binding	IPI	molecular function
GO:0050778	positive regulation of immune response	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)