• Gene id: 282617

Gene Summary

• Gene Symbol: IFNL3   Gene   UCSC   Ensembl
• Aliases: IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C
• Gene name: interferon lambda 3
• Alternate names: interferon lambda-3, cytokine Zcyto22, interferon, lambda 4, interleukin-28B, interleukin-28C,
• Gene location: 19q13.2 (39245076: 39243552)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region map
• OMIM: 610958

Protein Summary

• Protein general information: Q8IZI9  
  • Name: Interferon lambda 3 (IFN lambda 3) (Cytokine Zcyto22) (Interleukin 28B) (IL 28B) (Interleukin 28C) (IL 28C)
  • Length: 196  
  • Mass: 21706
• Sequence:

  MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRL
  FPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGR
  LHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV

• Structural information:
  • Interpro: IPR038326  IPR029177  
  • PDB: 3HHC 5T5W
  • PDBsum: 3HHC 5T5W
  • STRING: ENSP00000409000
• Other Databases: GeneCards:  IFNL3  Malacards:  IFNL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0051607	defense response to virus	ISS	biological process
GO:0045071	negative regulation of viral genome replication	ISS	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0050778	positive regulation of immune response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Thrombocytopenia	PMID:24304453
Cryoglobulinemia	PMID:24293567
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881