• Gene id: 28234

Gene Summary

• Gene Symbol: SLCO1B3   Gene   UCSC   Ensembl
• Aliases: HBLRR, LST-2, LST-3TM13, LST3, OATP-8, OATP1B3, OATP8, SLC21A8
• Gene name: solute carrier organic anion transporter family member 1B3
• Alternate names: solute carrier organic anion transporter family member 1B3, liver-specific organic anion transporter 2, liver-specific organic anion transporter 3TM13, organic anion transporter 8, organic anion transporter LST-3c, organic anion-transporting polypeptide 8, solu,
• Gene location: 12p12.2 (20810704: 20916910)     Exons: 17     NC_000012.12
• Gene summary(Entrez): This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of endogenous and xenobiotic compounds and plays a critical role in bile acid an
• OMIM: 605495

Protein Summary

• Protein general information: Q9NPD5  
  • Name: Solute carrier organic anion transporter family member 1B3 (Liver specific organic anion transporter 2) (LST 2) (Organic anion transporter 8) (Organic anion transporting polypeptide 8) (OATP 8) (Solute carrier family 21 member 8)
  • Length: 702  
  • Mass: 77403
  • Tissue specificity: Highly expressed in liver, in particular at the basolateral membrane of hepatocytes near the central vein. Not detected in other tissues. Highly expressed in some cancer cell lines derived from colon, pancreas, liver and gall bladder.
• Sequence:

  MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFDISSSLAGLIDGSFEI
  GNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGYYRYSKETHINPSENSTSSLSTCLINQTLSF
  NGTSPEIVEKDCVKESGSHMWIYVFMGNMLRGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFA
  LGSLFAKMYVDIGYVDLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
  TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVFKYMEQQYGQSASHAN
  FLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFLFQLLYFPLICESKSVAGLTLTYDGNNSVAS
  HVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECP
  RDNTCTRKFFIYVAIQVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
  KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASDNERKVMDEANLEFLN
  NGEHFVPSAGTDSKTCNLDMQDNAAAN

• Structural information:
  • Protein Domains: (453..50-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798"-)
  • Interpro: IPR002350  IPR036058  IPR020846  IPR036259  IPR004156  
  • Prosite: PS51465 PS50850
  • STRING: ENSP00000261196
• Other Databases: GeneCards:  SLCO1B3  Malacards:  SLCO1B3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0043252	sodium-independent organic anion transport	IBA	biological process
GO:0015125	bile acid transmembrane transporter activity	IBA	molecular function
GO:0015347	sodium-independent organic anion transmembrane transporter activity	IBA	molecular function
GO:0015721	bile acid and bile salt transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008514	organic anion transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0015711	organic anion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0043252	sodium-independent organic anion transport	TAS	biological process
GO:0015125	bile acid transmembrane transporter activity	TAS	molecular function
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04976	Bile secretion

Diseases

Associated diseases	References
Hyperbilirubinemia	KEGG:H00208
Rotor syndrome	KEGG:H02057
Hyperbilirubinemia	KEGG:H00208
Rotor syndrome	KEGG:H02057
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq