• Gene id: 2822

Gene Summary

• Gene Symbol: GPLD1   Gene   UCSC   Ensembl
• Aliases: GPIPLD, GPIPLDM, PIGPLD, PIGPLD1, PLD
• Gene name: glycosylphosphatidylinositol specific phospholipase D1
• Alternate names: phosphatidylinositol-glycan-specific phospholipase D, GPI-PLD, GPI-specific phospholipase D, PI-G PLD, glycoprotein phospholipase D,
• Gene location: 6p22.3 (24495231: 24423968)     Exons: 14     NC_000006.12
• Gene summary(Entrez): Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glyco
• OMIM: 602515

Protein Summary

• Protein general information: P80108  
  • Name: Phosphatidylinositol glycan specific phospholipase D (PI G PLD) (EC 3.1.4.50) (Glycoprotein phospholipase D) (Glycosyl phosphatidylinositol specific phospholipase D) (GPI PLD) (GPI specific phospholipase D)
  • Length: 840  
  • Mass: 92336
• Sequence:

  MSAFRLWPGLLIMLGSLCHRGSPCGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCFYPSIC
  KGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDF
  HGSYSEAHSAGDFGGDVLSQFEFNFNYLARRWYVPVKDLLGIYEKLYGRKVITENVIVDCSHIQFLEMYGEMLAV
  SKLYPTYSTKSPFLVEQFQEYFLGGLDDMAFWSTNIYHLTSFMLENGTSDCNLPENPLFIACGGQQNHTQGSKMQ
  KNDFHRNLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRTMFIGGSQLSQKHVSSPLASYFLS
  FPYARLGWAMTSADLNQDGHGDLVVGAPGYSRPGHIHIGRVYLIYGNDLGLPPVDLDLDKEAHRILEGFQPSGRF
  GSALAVLDFNVDGVPDLAVGAPSVGSEQLTYKGAVYVYFGSKQGGMSSSPNITISCQDIYCNLGWTLLAADVNGD
  SEPDLVIGSPFAPGGGKQKGIVAAFYSGPSLSDKEKLNVEAANWTVRGEEDFSWFGYSLHGVTVDNRTLLLVGSP
  TWKNASRLGHLLHIRDEKKSLGRVYGYFPPNGQSWFTISGDKAMGKLGTSLSSGHVLMNGTLKQVLLVGAPTYDD
  VSKVAFLTVTLHQGGATRMYALTSDAQPLLLSTFSGDRRFSRFGGVLHLSDLDDDGLDEIIMAAPLRIADVTSGL
  IGGEDGRVYVYNGKETTLGDMTGKCKSWITPCPEEKAQYVLISPEASSRFGSSLITVRSKAKNQVVIAAGRSSLG
  ARLSGALHVYSLGSD

• Structural information:
  • Interpro: IPR013517  IPR001028  IPR013519  IPR028994  IPR029002  
  • Prosite: PS51470
  • STRING: ENSP00000230036
• Other Databases: GeneCards:  GPLD1  Malacards:  GPLD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0006507	GPI anchor release	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	IEA	molecular function
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	TAS	molecular function
GO:0006501	C-terminal protein lipidation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0035690	cellular response to drug	IDA	biological process
GO:0009749	response to glucose	IDA	biological process
GO:0006507	GPI anchor release	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0002430	complement receptor mediated signaling pathway	IDA	biological process
GO:0002430	complement receptor mediated signaling pathway	IDA	biological process
GO:1900076	regulation of cellular response to insulin stimulus	IDA	biological process
GO:0071467	cellular response to pH	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0004630	phospholipase D activity	IDA	molecular function
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	IDA	molecular function
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	IDA	molecular function
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	IDA	molecular function
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	IDA	molecular function
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IDA	biological process
GO:0008286	insulin receptor signaling pathway	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0006507	GPI anchor release	IDA	biological process
GO:0006507	GPI anchor release	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	IDA	molecular function
GO:0097241	hematopoietic stem cell migration to bone marrow	TAS	biological process
GO:0071397	cellular response to cholesterol	IMP	biological process
GO:0010867	positive regulation of triglyceride biosynthetic process	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0002062	chondrocyte differentiation	ISS	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0070633	transepithelial transport	ISS	biological process
GO:0046470	phosphatidylcholine metabolic process	TAS	biological process
GO:0035701	hematopoietic stem cell migration	TAS	biological process
GO:0010983	positive regulation of high-density lipoprotein particle clearance	ISS	biological process
GO:0010907	positive regulation of glucose metabolic process	ISS	biological process
GO:0010694	positive regulation of alkaline phosphatase activity	ISS	biological process
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0031012	extracellular matrix	ISS	cellular component
GO:0051047	positive regulation of secretion	ISS	biological process
GO:0046470	phosphatidylcholine metabolic process	ISS	biological process
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	ISS	biological process
GO:0010897	negative regulation of triglyceride catabolic process	ISS	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0006507	GPI anchor release	IMP	biological process
GO:0001503	ossification	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071401	cellular response to triglyceride	IMP	biological process
GO:0017080	sodium channel regulator activity	ISS	molecular function
GO:0004621	glycosylphosphatidylinositol phospholipase D activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00563	Glycosylphosphatidylinositol

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R