• Gene id: 2821

Gene Summary

• Gene Symbol: GPI   Gene   UCSC   Ensembl
• Aliases: AMF, GNPI, NLK, PGI, PHI, SA-36, SA36
• Gene name: glucose-6-phosphate isomerase
• Alternate names: glucose-6-phosphate isomerase, autocrine motility factor, hexose monophosphate isomerase, hexosephosphate isomerase, neuroleukin, oxoisomerase, phosphoglucose isomerase, phosphohexomutase, phosphohexose isomerase, phosphosaccharomutase, sperm antigen-36,
• Gene location: 19q13.11 (34353329: 34402412)     Exons: 20     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product function
• OMIM: 172400

Protein Summary

• Protein general information: P06744  
  • Name: Glucose 6 phosphate isomerase (GPI) (EC 5.3.1.9) (Autocrine motility factor) (AMF) (Neuroleukin) (NLK) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) (Sperm antigen 36) (SA 36)
  • Length: 558  
  • Mass: 63147
• Sequence:

  MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSR
  GVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMPEVNKVLDKMKSFCQRVRSGDWKGYTGKTIT
  DVINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETA
  KEWFLQAAKDPSAVAKHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
  HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQT
  GPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQ
  AAGKSPEDLERLLPHKVFEGNRPTNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKI
  EPELDGSAQVTSHDASTNGLINFIKQQREARVQ

• Structural information:
  • Interpro: IPR001672  IPR023096  IPR018189  IPR035476  IPR035482  
  • Prosite: PS00765 PS00174 PS51463
  • CDD: cd05015 cd05016
  • PDB: 1IAT 1IRI 1JIQ 1JLH 1NUH
  • PDBsum: 1IAT 1IRI 1JIQ 1JLH 1NUH
  • STRING: ENSP00000405573
• Other Databases: GeneCards:  GPI  Malacards:  GPI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006094	gluconeogenesis	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	NAS	biological process
GO:0006959	humoral immune response	TAS	biological process
GO:0007599	hemostasis	TAS	biological process
GO:0004347	glucose-6-phosphate isomerase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0051024	positive regulation of immunoglobulin secretion	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0006094	gluconeogenesis	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0051156	glucose 6-phosphate metabolic process	IBA	biological process
GO:0048029	monosaccharide binding	IBA	molecular function
GO:0006096	glycolytic process	IBA	biological process
GO:0004347	glucose-6-phosphate isomerase activity	IBA	molecular function
GO:0051156	glucose 6-phosphate metabolic process	IDA	biological process
GO:0004347	glucose-6-phosphate isomerase activity	IDA	molecular function
GO:0006094	gluconeogenesis	IEA	biological process
GO:0004347	glucose-6-phosphate isomerase activity	IEA	molecular function
GO:0006096	glycolytic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa00010	Glycolysis / Gluconeogenesis
hsa00520	Amino sugar and nucleotide sugar metabolism
hsa00030	Pentose phosphate pathway
hsa00500	Starch and sucrose metabolism

Diseases

Associated diseases	References
Anemia due to disorders of glycolytic enzymes	KEGG:H00664
Anemia due to disorders of glycolytic enzymes	KEGG:H00664
Intellectual disability	PMID:9856489
Congenital nonspherocytic hemolytic anemia	PMID:17041899
Neuromuscular disease	PMID:9856489
Congenital hemolytic anemia	PMID:9856489
Congenital hemolytic anemia	PMID:8499925
acute myeloid leukemia	PMID:6589021
acute lymphocytic leukemia	PMID:6589021
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R