• Gene id: 2817

Gene Summary

• Gene Symbol: GPC1   Gene   UCSC   Ensembl
• Aliases: glypican
• Gene name: glypican 1
• Alternate names: glypican-1, epididymis secretory sperm binding protein, glypican proteoglycan 1,
• Gene location: 2q37.3 (240435662: 240468075)     Exons: 10     NC_000002.12
• Gene summary(Entrez): Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protei
• OMIM: 607638

Protein Summary

• Protein general information: P35052  
  • Name: Glypican 1 [Cleaved into: Secreted glypican 1]
  • Length: 558  
  • Mass: 61680
• Sequence:

  MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEE
  NLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRL
  YYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQ
  GLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLI
  TDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTL
  EKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPD
  MTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQE
  GQKTSAASCPQPPTFLLPLLLFLALTVARPRWR

• Structural information:
  • Interpro: IPR001863  IPR015502  IPR019803  
  • Prosite: PS01207
  • PDB: 4ACR 4AD7 4BWE 4YWT
  • PDBsum: 4ACR 4AD7 4BWE 4YWT
  • STRING: ENSP00000264039
• Other Databases: GeneCards:  GPC1  Malacards:  GPC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070062	extracellular exosome	HDA	cellular component
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0009966	regulation of signal transduction	IEA	biological process
GO:1905475	regulation of protein localization to membrane	IBA	biological process
GO:0017134	fibroblast growth factor binding	IBA	molecular function
GO:0016477	cell migration	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006027	glycosaminoglycan catabolic process	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0017134	fibroblast growth factor binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0043236	laminin binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:2001016	positive regulation of skeletal muscle cell differentiation	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0045121	membrane raft	IDA	colocalizes with
GO:0005507	copper ion binding	IDA	molecular function
GO:0030200	heparan sulfate proteoglycan catabolic process	IDA	biological process
GO:0045121	membrane raft	ISS	cellular component
GO:0032288	myelin assembly	ISS	biological process
GO:0017134	fibroblast growth factor binding	ISS	molecular function
GO:0031012	extracellular matrix	ISS	cellular component
GO:2001016	positive regulation of skeletal muscle cell differentiation	ISS	biological process
GO:0043236	laminin binding	ISS	molecular function
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0014037	Schwann cell differentiation	ISS	biological process
GO:0031226	intrinsic component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05205	Proteoglycans in cancer
hsa05418	Fluid shear stress and atherosclerosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq