• Gene id: 2813

Gene Summary

• Gene Symbol: GP2   Gene   UCSC   Ensembl
• Aliases: ZAP75
• Gene name: glycoprotein 2
• Alternate names: pancreatic secretory granule membrane major glycoprotein GP2, glycoprotein 2 (zymogen granule membrane), pancreatic zymogen granule membrane associated protein GP2,
• Gene location: 16p12.3 (20327512: 20309573)     Exons: 12     NC_000016.10
• Gene summary(Entrez): This gene encodes an integral membrane protein that is secreted from intracellular zymogen granules and associates with the plasma membrane via glycosylphosphatidylinositol (GPI) linkage. The encoded protein binds pathogens such as enterobacteria, thereby
• OMIM: 602977

Protein Summary

• Protein general information: P55259  
  • Name: Pancreatic secretory granule membrane major glycoprotein GP2 (Pancreatic zymogen granule membrane protein GP 2) (ZAP75)
  • Length: 537  
  • Mass: 59480
  • Tissue specificity: Pancreatic secretory (zymogen) granule.
• Sequence:

  MPHLMERMVGSGLLWLALVSCILTQASAVQRGYGNPIEASSYGLDLDCGAPGTPEAHVCFDPCQNYTLLDEPFRS
  TENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKT
  EVLVKACPGGYHVYRLEGTPWCNLRYCTVPRDPSTVEDKCEKACRPEEECLALNSTWGCFCRQDLNSSDVHSLQP
  QLDCGPREIKVKVDKCLLGGLGLGEEVIAYLRDPNCSSILQTEERNWVSVTSPVQASACRNILERNQTHAIYKNT
  LSLVNDFIIRDTILNINFQCAYPLDMKVSLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELS
  VESVLYVGAILEQGDTSRFNLVLRNCYATPTEDKADLVKYFIIRNSCSNQRDSTIHVEENGQSSESRFSVQMFMF
  AGHYDLVFLHCEIHLCDSLNEQCQPSCSRSQVRSEVPAIDLARVLDLGPITRRGAQSPGVMNGTPSTAGFLVAWP
  MVLLTVLLAWLF

• Structural information:
  • Protein Domains: (186..23-)
    (/note="EGF-like-)
    (228..48-)
    (/note="ZP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00375"-)
  • Interpro: IPR001507  IPR017977  
  • Prosite: PS00682 PS51034
  • STRING: ENSP00000370767
• Other Databases: GeneCards:  GP2  Malacards:  GP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990266	neutrophil migration	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005201	extracellular matrix structural constituent	IBA	molecular function
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R