• Gene id: 2811

Gene Summary

• Gene Symbol: GP1BA   Gene   UCSC   Ensembl
• Aliases: BDPLT1, BDPLT3, BSS, CD42B, CD42b-alpha, DBPLT3, GP1B, GPIbA, GPIbalpha, VWDP
• Gene name: glycoprotein Ib platelet subunit alpha
• Alternate names: platelet glycoprotein Ib alpha chain, GP-Ib alpha, antigen CD42b-alpha, glycoprotein Ib (platelet), alpha polypeptide, glycoprotein Ib platelet alpha subunit, mutant platelet membrane glycoprotein Ib-alpha, platelet membrane glycoprotein 1b-alpha subunit, platel,
• Gene location: 17p13.2 (4932276: 4935022)     Exons: 2     NC_000017.11
• Gene summary(Entrez): Glycoprotein Ib (GP Ib) is a platelet surface membrane glycoprotein composed of a heterodimer, an alpha chain and a beta chain, that is linked by disulfide bonds. The Gp Ib functions as a receptor for von Willebrand factor (VWF). The complete receptor com

Protein Summary

• Protein general information: P07359  
  • Name: Platelet glycoprotein Ib alpha chain (GP Ib alpha) (GPIb alpha) (GPIbA) (Glycoprotein Ibalpha) (Antigen CD42b alpha) (CD antigen CD42b) [Cleaved into: Glycocalicin]
  • Length: 652  
  • Mass: 71540
• Sequence:

  MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQ
  LNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGN
  ELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLC
  NCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDT
  EGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWTPNFTLHMESITFSKT
  PKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTSEPAPSPTTP
  EPTPIPTIATSPTILVSATSLITPKSTFLTTTKPVSLLESTKKTIPELDQPPKLRGVLQGHLESSRNDPFLHPDF
  CCLLPLGFYVLGLFWLLFASVVLILLLSWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRG
  SLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL

• Structural information:
  • Protein Domains: (17..4-)
    (/note="LRRNT-)
    (221..28-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • PDB: 1GWB 1K13 1M0Z 1M10 1OOK 1P8V 1P9A 1QYY 1SQ0 1U0N 2BP3 3P72 3PMH 4C2A 4C2B 4CH2 4CH8 4MGX 4YR6
  • PDBsum: 1GWB 1K13 1M0Z 1M10 1OOK 1P8V 1P9A 1QYY 1SQ0 1U0N 2BP3 3P72 3PMH 4C2A 4C2B 4CH2 4CH8 4MGX 4YR6
  • STRING: ENSP00000329380
• Other Databases: GeneCards:  GP1BA  Malacards:  GP1BA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070527	platelet aggregation	IBA	biological process
GO:0031362	anchored component of external side of plasma membrane	IBA	colocalizes with
GO:0007155	cell adhesion	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0007596	blood coagulation	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007599	hemostasis	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0015057	thrombin-activated receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0007155	cell adhesion	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0007596	blood coagulation	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007597	blood coagulation, intrinsic pathway	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007599	hemostasis	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0070527	platelet aggregation	IEA	biological process
GO:0031362	anchored component of external side of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0070493	thrombin-activated receptor signaling pathway	IEA	biological process
GO:0070493	thrombin-activated receptor signaling pathway	IEA	biological process
GO:0031362	anchored component of external side of plasma membrane	IDA	colocalizes with
GO:0042730	fibrinolysis	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0015057	thrombin-activated receptor activity	TAS	molecular function
GO:0009986	cell surface	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030193	regulation of blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04611	Platelet activation
hsa04512	ECM-receptor interaction
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Macrothrombocytopenia	KEGG:H01740
Bernard-Soulier syndrome	KEGG:H00224
Hemophilia	KEGG:H00219
Platelet-type von Willebrand disease	KEGG:H02093
Macrothrombocytopenia	KEGG:H01740
Bernard-Soulier syndrome	KEGG:H00224
Hemophilia	KEGG:H00219
Platelet-type von Willebrand disease	KEGG:H02093
Platelet-type bleeding disorder 3	PMID:15705799
Diabetic angiopathy	PMID:21411989
Nephrotic syndrome	PMID:12185480
Bernard-Soulier syndrome	PMID:22044935
Myocardial infarction	PMID:15269835
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R