• Gene id: 2810

Gene Summary

• Gene Symbol: SFN   Gene   UCSC   Ensembl
• Aliases: YWHAS
• Gene name: stratifin
• Alternate names: 14-3-3 protein sigma, epithelial cell marker protein 1,
• Gene location: 1p36.11 (26863148: 26864455)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mit
• OMIM: 615038

Protein Summary

• Protein general information: P31947  
  • Name: 14 3 3 protein sigma (Epithelial cell marker protein 1) (Stratifin)
  • Length: 248  
  • Mass: 27774
  • Tissue specificity: Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
• Sequence:

  MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE
  EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSA
  YQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRD
  NLTLWTADNAGEEGGEAPQEPQS

• Structural information:
  • Interpro: IPR000308  IPR023409  IPR036815  IPR023410  IPR037435  
  • Prosite: PS00796 PS00797
  • CDD: cd10019
  • PDB: 1YWT 1YZ5 3IQJ 3IQU 3IQV 3LW1 3MHR 3O8I 3P1N 3P1O 3P1P 3P1Q 3P1R 3P1S 3SMK 3SML 3SMM 3SMN 3SMO 3SP5 3SPR 3T0L 3T0M 3U9X 3UX0 4DAT 4DAU 4DHM 4DHN 4DHO 4DHP 4DHQ 4DHR 4DHS 4DHT 4DHU 4FL5 4FR3 4IEA 4JC3 4JDD 4QLI 4Y32 4Y3B 4Y5I 5BTV 5HF3 5LTW 5LU1 5LU2 5MHC 5MOC 5MXO 5MY9 5MYC 5N5R 5N5T 5N5W 5N75 5OEG 5OEH 5OK9 5OKF 5OM
  • PDBsum: 1YWT 1YZ5 3IQJ 3IQU 3IQV 3LW1 3MHR 3O8I 3P1N 3P1O 3P1P 3P1Q 3P1R 3P1S 3SMK 3SML 3SMM 3SMN 3SMO 3SP5 3SPR 3T0L 3T0M 3U9X 3UX0 4DAT 4DAU 4DHM 4DHN 4DHO 4DHP 4DHQ 4DHR 4DHS 4DHT 4DHU 4FL5 4FR3 4IEA 4JC3 4JDD 4QLI 4Y32 4Y3B 4Y5I 5BTV 5HF3 5LTW 5LU1 5LU2 5MHC 5MOC 5MXO 5MY9 5MYC 5N5R 5N5T 5N5W 5N75 5OEG 5OEH 5OK9 5OKF 5OM
  • DIP: 29861
  • STRING: ENSP00000340989
• Other Databases: GeneCards:  SFN  Malacards:  SFN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0045606	positive regulation of epidermal cell differentiation	ISS	biological process
GO:0010482	regulation of epidermal cell division	ISS	biological process
GO:0061436	establishment of skin barrier	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008426	protein kinase C inhibitor activity	TAS	molecular function
GO:0006469	negative regulation of protein kinase activity	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010482	regulation of epidermal cell division	IEA	biological process
GO:0010839	negative regulation of keratinocyte proliferation	IEA	biological process
GO:0045606	positive regulation of epidermal cell differentiation	IEA	biological process
GO:0046827	positive regulation of protein export from nucleus	IEA	biological process
GO:0051219	phosphoprotein binding	IEA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0003334	keratinocyte development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0030216	keratinocyte differentiation	IEA	biological process
GO:0030307	positive regulation of cell growth	IEA	biological process
GO:0031424	keratinization	IEA	biological process
GO:0043588	skin development	IEA	biological process
GO:0061436	establishment of skin barrier	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle
hsa04115	p53 signaling pathway
hsa04960	Aldosterone-regulated sodium reabsorption

Diseases

Associated diseases	References
urinary bladder cancer	PMID:18452837
Vulva squamous cell carcinoma	PMID:11896620
Ovarian cancer	PMID:16773180
Ovarian cancer	PMID:15102672
Transitional cell carcinoma	PMID:16964403
Endometrial carcinoma	PMID:16271083
in situ carcinoma	PMID:11896620
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R