• Gene id: 280636

Gene Summary

• Gene Symbol: SELENOH   Gene   UCSC   Ensembl
• Aliases: C11orf31, C17orf10, SELH
• Gene name: selenoprotein H
• Alternate names: selenoprotein H,
• Gene location: 11q12.1 (132887617: 132832355)     Exons: 19     NC_000012.12
• Gene summary(Entrez): This gene encodes a nucleolar protein, which belongs to the SelWTH family. It functions as an oxidoreductase, and has been shown to protect neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, promote mitochondrial biogenesis an
• OMIM: 607914

Protein Summary

• Protein general information: Q8IZQ5  
  • Name: Selenoprotein H (SelH)
  • Length: 122  
  • Mass: 13453
• Sequence:

  MAPRGRKRKAEAAVVAVAEKREKLANGGEGMEEATVVIEHCTSURVYGRNAAALSQALRLEAPELPVKVNPTKPR
  RGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEELKKYLS

• Structural information:
  • Interpro: IPR011893  IPR036249  
  • STRING: ENSP00000373509
• Other Databases: GeneCards:  SELENOH  Malacards:  SELENOH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0048856	anatomical structure development	IBA	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray