• Gene id: 2806

Gene Summary

• Gene Symbol: GOT2   Gene   UCSC   Ensembl
• Aliases: KAT4, KATIV, KYAT4, mitAAT
• Gene name: glutamic-oxaloacetic transaminase 2
• Alternate names: aspartate aminotransferase, mitochondrial, FABP-1, FABPpm, aspartate aminotransferase 2, aspartate transaminase 2, fatty acid-binding protein, glutamate oxaloacetate transaminase 2, glutamic-oxaloacetic transaminase 2, mitochondrial, kynurenine aminotransferase 4,
• Gene location: 16q21 (58734315: 58707130)     Exons: 10     NC_000016.10
• Gene summary(Entrez): Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycl
• OMIM: 604087

Protein Summary

• Protein general information: P00505  
  • Name: Aspartate aminotransferase, mitochondrial (mAspAT) (EC 2.6.1.1) (EC 2.6.1.7) (Fatty acid binding protein) (FABP 1) (Glutamate oxaloacetate transaminase 2) (Kynurenine aminotransferase 4) (Kynurenine aminotransferase IV) (Kynurenine oxoglutarate transamin
  • Length: 430  
  • Mass: 47518
• Sequence:

  MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPY
  VLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFK
  FSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQ
  WKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADE
  AKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHIT
  DQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK

• Structural information:
  • Interpro: IPR004839  IPR000796  IPR004838  IPR015424  IPR015422   IPR015421  
  • Prosite: PS00105
  • PDB: 5AX8
  • PDBsum: 5AX8
  • STRING: ENSP00000245206
• Other Databases: GeneCards:  GOT2  Malacards:  GOT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0006533	aspartate catabolic process	IBA	biological process
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IBA	molecular function
GO:0006531	aspartate metabolic process	ISS	biological process
GO:0006103	2-oxoglutarate metabolic process	ISS	biological process
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	ISS	molecular function
GO:0006536	glutamate metabolic process	ISS	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:0009058	biosynthetic process	IEA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006520	cellular amino acid metabolic process	IEA	biological process
GO:0008483	transaminase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0008483	transaminase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0016212	kynurenine-oxoglutarate transaminase activity	IEA	molecular function
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0008652	cellular amino acid biosynthetic process	TAS	biological process
GO:0046487	glyoxylate metabolic process	TAS	biological process
GO:0043648	dicarboxylic acid metabolic process	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032868	response to insulin	IEA	biological process
GO:0031406	carboxylic acid binding	IEA	molecular function
GO:0030315	T-tubule	IEA	cellular component
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0019551	glutamate catabolic process to 2-oxoglutarate	IEA	biological process
GO:0016597	amino acid binding	IEA	molecular function
GO:0014850	response to muscle activity	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0006531	aspartate metabolic process	IEA	biological process
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IEA	molecular function
GO:0019551	glutamate catabolic process to 2-oxoglutarate	IEA	biological process
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IEA	molecular function
GO:0043204	perikaryon	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0042383	sarcolemma	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0006520	cellular amino acid metabolic process	IEA	biological process
GO:0006107	oxaloacetate metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005543	phospholipid binding	IEA	molecular function
GO:0019550	glutamate catabolic process to aspartate	IEA	biological process
GO:0006532	aspartate biosynthetic process	IEA	biological process
GO:0006107	oxaloacetate metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0019470	4-hydroxyproline catabolic process	TAS	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0097052	L-kynurenine metabolic process	IEA	biological process
GO:0045471	response to ethanol	IDA	biological process
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IDA	molecular function
GO:0006533	aspartate catabolic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IDA	molecular function
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0015908	fatty acid transport	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00330	Arginine and proline metabolism
hsa00270	Cysteine and methionine metabolism
hsa00250	Alanine, aspartate and glutamate metabolism
hsa04975	Fat digestion and absorption
hsa00350	Tyrosine metabolism
hsa01210	2-Oxocarboxylic acid metabolism
hsa00360	Phenylalanine metabolism
hsa00220	Arginine biosynthesis
hsa00400	Phenylalanine, tyrosine and tryptophan biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881