• Gene id: 2805

Gene Summary

• Gene Symbol: GOT1   Gene   UCSC   Ensembl
• Aliases: AST1, ASTQTL1, GIG18, cAspAT, cCAT
• Gene name: glutamic-oxaloacetic transaminase 1
• Alternate names: aspartate aminotransferase, cytoplasmic, aspartate aminotransferase 1, aspartate transaminase 1, cysteine aminotransferase, cytoplasmic, cysteine transaminase, cytoplasmic, glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble, grow,
• Gene location: 10q24.2 (99430623: 99396869)     Exons: 14     NC_000010.11
• Gene summary(Entrez): Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two en
• OMIM: 138180

Protein Summary

• Protein general information: P17174  
  • Name: Aspartate aminotransferase, cytoplasmic (cAspAT) (EC 2.6.1.1) (EC 2.6.1.3) (Cysteine aminotransferase, cytoplasmic) (Cysteine transaminase, cytoplasmic) (cCAT) (Glutamate oxaloacetate transaminase 1) (Transaminase A)
  • Length: 413  
  • Mass: 46248
• Sequence:

  MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPIL
  GLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSA
  AGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSA
  YQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPP
  AQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLV
  NEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ

• Structural information:
  • Interpro: IPR004839  IPR000796  IPR004838  IPR015424  IPR015422   IPR015421  
  • Prosite: PS00105
  • PDB: 3II0 3WZF 6DNA 6DNB 6DND
  • PDBsum: 3II0 3WZF 6DNA 6DNB 6DND
  • STRING: ENSP00000359539
• Other Databases: GeneCards:  GOT1  Malacards:  GOT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006532	aspartate biosynthetic process	IBA	biological process
GO:0006531	aspartate metabolic process	ISS	biological process
GO:0006103	2-oxoglutarate metabolic process	ISS	biological process
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	ISS	molecular function
GO:0047801	L-cysteine:2-oxoglutarate aminotransferase activity	ISS	molecular function
GO:0006536	glutamate metabolic process	ISS	biological process
GO:0006114	glycerol biosynthetic process	ISS	biological process
GO:0009058	biosynthetic process	IEA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006520	cellular amino acid metabolic process	IEA	biological process
GO:0008483	transaminase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008652	cellular amino acid biosynthetic process	IEA	biological process
GO:0008483	transaminase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IEA	molecular function
GO:0047801	L-cysteine:2-oxoglutarate aminotransferase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0008652	cellular amino acid biosynthetic process	TAS	biological process
GO:0019551	glutamate catabolic process to 2-oxoglutarate	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IEA	molecular function
GO:1990267	response to transition metal nanoparticle	IEA	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0043648	dicarboxylic acid metabolic process	IEA	biological process
GO:0032966	negative regulation of collagen biosynthetic process	IEA	biological process
GO:0031406	carboxylic acid binding	IEA	molecular function
GO:0019551	glutamate catabolic process to 2-oxoglutarate	IEA	biological process
GO:0009743	response to carbohydrate	IEA	biological process
GO:0006531	aspartate metabolic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IEA	molecular function
GO:0055089	fatty acid homeostasis	IEA	biological process
GO:0019550	glutamate catabolic process to aspartate	IEA	biological process
GO:0006532	aspartate biosynthetic process	IEA	biological process
GO:0006114	glycerol biosynthetic process	IEA	biological process
GO:0006107	oxaloacetate metabolic process	IEA	biological process
GO:0004609	phosphatidylserine decarboxylase activity	IEA	molecular function
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0060290	transdifferentiation	IEA	biological process
GO:0051902	negative regulation of mitochondrial depolarization	IEA	biological process
GO:0051481	negative regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0047801	L-cysteine:2-oxoglutarate aminotransferase activity	IEA	molecular function
GO:0043679	axon terminus	IEA	cellular component
GO:0035902	response to immobilization stress	IEA	biological process
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0006114	glycerol biosynthetic process	IEA	biological process
GO:0006107	oxaloacetate metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IDA	molecular function
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IDA	molecular function
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IDA	molecular function
GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	IDA	molecular function
GO:0006533	aspartate catabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0051384	response to glucocorticoid	IEP	biological process
GO:0032869	cellular response to insulin stimulus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00330	Arginine and proline metabolism
hsa00270	Cysteine and methionine metabolism
hsa00250	Alanine, aspartate and glutamate metabolism
hsa00350	Tyrosine metabolism
hsa01210	2-Oxocarboxylic acid metabolism
hsa00360	Phenylalanine metabolism
hsa00220	Arginine biosynthesis
hsa00400	Phenylalanine, tyrosine and tryptophan biosynthesis

Diseases

Associated diseases	References
Transient cerebral ischemia	PMID:24407245
Amyotrophic lateral sclerosis	PMID:26113413
pancreatic ductal adenocarcinoma	PMID:23535601
Amyloidosis	PMID:28390893
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R