• Gene id: 2797

Gene Summary

• Gene Symbol: GNRH2   Gene   UCSC   Ensembl
• Aliases: GnRH-II, LH-RHII
• Gene name: gonadotropin releasing hormone 2
• Alternate names: progonadoliberin-2, GnRH-associated peptide 2, GnRH-associated peptide II, Gonadoliberin II, Gonadoliberin-2, luliberin II, luteinizing hormone-releasing hormone II, progonadoliberin II,
• Gene location: 20p13 (3039060: 3045895)     Exons: 5     NC_000020.11
• Gene summary(Entrez): This gene encodes a secreted peptide hormone and member of the gonadotropin-releasing hormone (GnRH) family of proteins. The encoded protein regulates reproductive function by stimulating the production and release of the gonadotropins follicle-stimulatin
• OMIM: 602352

Protein Summary

• Protein general information: O43555  
  • Name: Progonadoliberin 2 (Progonadoliberin II) [Cleaved into: Gonadoliberin 2 (Gonadoliberin II) (Gonadotropin releasing hormone II) (GnRH II) (Luliberin II) (Luteinizing hormone releasing hormone II) (LH RH II); GnRH associated peptide 2 (GnRH associated pepti
  • Length: 120  
  • Mass: 12,918
• Sequence:

  MASSRRGLLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDALA
  PLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV

• Structural information:
  • Interpro: IPR002012  IPR019792  
  • Prosite: PS00473
  • STRING: ENSP00000245983
• Other Databases: GeneCards:  GNRH2  Malacards:  GNRH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005179	hormone activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04929	GnRH secretion
hsa04912	GnRH signaling pathway

Diseases

Associated diseases	References
Cancer	GAD: 19064572
Cancer (epithelial ovarian)	GAD: 19064572
Bone diseases	GAD: 19453261
Psychological disorders	GAD: 19086053
Several psychiatric disorders	GAD: 19086053
Sertoli cell only syndrome (SCOS)	MIK: 18082732
Male factor infertility	MIK: 18082732
Spermatogenesis defects	MIK: 18082732
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 18082732
Spermatogenic failure	MIK: 18082732
Sertoli- cell only syndrome	MIK: 18082732
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18082732	Male infertility, Spermatogenic failure, Sertoli- cell only syndrome			34 azoospermic men	Male infertility	GnRH-I GnRH-II GnRH-R CYP11A1 HSD3B2
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray