• Gene id: 2792

Gene Summary

• Gene Symbol: GNGT1   Gene   UCSC   Ensembl
• Aliases: GNG1
• Gene name: G protein subunit gamma transducin 1
• Alternate names: guanine nucleotide-binding protein G(T) subunit gamma-T1, guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1, transducin gamma chain,
• Gene location: 7q21.3 (93906566: 93911264)     Exons: 4     NC_000007.14
• Gene summary(Entrez): This gene encodes the gamma subunit of transducin, a guanine nucleotide-binding protein (G protein) that is found in rod outer segments. Transducin, also known as GMPase, mediates the activation of a cyclic GTP-specific (guanosine monophosphate) phosphodi
• OMIM: 189970

Protein Summary

• Protein general information: P63211  
  • Name: Guanine nucleotide binding protein G(T) subunit gamma T1 (Transducin gamma chain)
  • Length: 74  
  • Mass: 8496
  • Tissue specificity: Retinal rod outer segment.
• Sequence:

  MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS

• Structural information:
  • Interpro: IPR015898  IPR036284  IPR001770  
  • Prosite: PS50058
  • CDD: cd00068
  • DIP: 471
  • STRING: ENSP00000248572
• Other Databases: GeneCards:  GNGT1  Malacards:  GNGT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031681	G-protein beta-subunit binding	IBA	molecular function
GO:0005834	heterotrimeric G-protein complex	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0031680	G-protein beta/gamma-subunit complex	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005834	heterotrimeric G-protein complex	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0003924	GTPase activity	TAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0097381	photoreceptor disc membrane	TAS	cellular component
GO:0097381	photoreceptor disc membrane	TAS	cellular component
GO:0016056	rhodopsin mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0010659	cardiac muscle cell apoptotic process	IEA	biological process
GO:0042462	eye photoreceptor cell development	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0007602	phototransduction	IEA	biological process
GO:0005834	heterotrimeric G-protein complex	IEA	cellular component
GO:0001917	photoreceptor inner segment	IEA	cellular component
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04014	Ras signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05034	Alcoholism
hsa05170	Human immunodeficiency virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04723	Retrograde endocannabinoid signaling
hsa04371	Apelin signaling pathway
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04726	Serotonergic synapse
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment
hsa04744	Phototransduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)