• Gene id: 2788

Gene Summary

• Gene Symbol: GNG7   Gene   UCSC   Ensembl
• Gene name: G protein subunit gamma 7
• Alternate names: guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7, guanine nucleotide binding protein (G protein), gamma 7,
• Gene location: 19p13.3 (805442: 813860)     Exons: 3     NC_000016.10
• OMIM: 604430

Protein Summary

• Protein general information: O60262  
  • Name: Guanine nucleotide binding protein G(I)/G(S)/G(O) subunit gamma 7
  • Length: 68  
  • Mass: 7522
  • Tissue specificity: Expressed in a variety of tissues. Down-regulated in pancreatic and esophageal cancer. {ECO
• Sequence:

  MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL

• Structural information:
  • Interpro: IPR015898  IPR036284  IPR001770  
  • Prosite: PS50058
  • CDD: cd00068
  • STRING: ENSP00000371594
• Other Databases: GeneCards:  GNG7  Malacards:  GNG7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031681	G-protein beta-subunit binding	IBA	molecular function
GO:0031680	G-protein beta/gamma-subunit complex	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005834	heterotrimeric G-protein complex	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005834	heterotrimeric G-protein complex	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04014	Ras signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05034	Alcoholism
hsa05170	Human immunodeficiency virus 1 infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04723	Retrograde endocannabinoid signaling
hsa04740	Olfactory transduction
hsa04371	Apelin signaling pathway
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04726	Serotonergic synapse
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray