• Gene id: 2773

Gene Summary

• Gene Symbol: GNAI3   Gene   UCSC   Ensembl
• Aliases: 87U6, ARCND1
• Gene name: G protein subunit alpha i3
• Alternate names: guanine nucleotide-binding protein G(i) subunit alpha, g(i) alpha-3, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3, guanine nucleotide-binding protein G(k) subunit alpha,
• Gene location: 1p13.3 (44207521: 44237267)     Exons: 9     NC_000019.10
• Gene summary(Entrez): Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling pathways. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes an alpha subunit and belongs to the G-alph
• OMIM: 139370

Protein Summary

• Protein general information: P08754  
  • Name: Guanine nucleotide binding protein G(i) subunit alpha (G(i) alpha 3)
  • Length: 354  
  • Mass: 40532
• Sequence:

  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYS
  NTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSREYQLND
  SASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCV
  ALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
  AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY

• Structural information:
  • Protein Domains: (32..35-)
    (/note="G-alpha-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01230"-)
  • Interpro: IPR001408  IPR001019  IPR011025  IPR027417  
  • Prosite: PS51882
  • CDD: cd00066
  • PDB: 2IHB 2ODE 2V4Z 4G5O 4G5R 4G5S
  • PDBsum: 2IHB 2ODE 2V4Z 4G5O 4G5R 4G5S
  • STRING: ENSP00000358867
• Other Databases: GeneCards:  GNAI3  Malacards:  GNAI3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005834	heterotrimeric G-protein complex	IBA	cellular component
GO:0031683	G-protein beta/gamma-subunit complex binding	IBA	molecular function
GO:0007212	dopamine receptor signaling pathway	IDA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	biological process
GO:0046039	GTP metabolic process	IDA	biological process
GO:0051301	cell division	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0019001	guanyl nucleotide binding	IEA	molecular function
GO:0031683	G-protein beta/gamma-subunit complex binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0007194	negative regulation of adenylate cyclase activity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0033864	positive regulation of NAD(P)H oxidase activity	IEA	biological process
GO:0032930	positive regulation of superoxide anion generation	IEA	biological process
GO:0031821	G protein-coupled serotonin receptor binding	IEA	molecular function
GO:0006906	vesicle fusion	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:0042588	zymogen granule	IEA	cellular component
GO:0032794	GTPase activating protein binding	IEA	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	colocalizes with
GO:0000139	Golgi membrane	IDA	colocalizes with
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0016239	positive regulation of macroautophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05012	Parkinson disease
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05034	Alcoholism
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa04022	cGMP-PKG signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04611	Platelet activation
hsa04926	Relaxin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04670	Leukocyte transendothelial migration
hsa04935	Growth hormone synthesis, secretion and action
hsa04915	Estrogen signaling pathway
hsa04726	Serotonergic synapse
hsa04916	Melanogenesis
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa05145	Toxoplasmosis
hsa04914	Progesterone-mediated oocyte maturation
hsa05142	Chagas disease
hsa04540	Gap junction
hsa04971	Gastric acid secretion
hsa04924	Renin secretion
hsa05133	Pertussis
hsa05030	Cocaine addiction
hsa04730	Long-term depression
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Auriculocondylar syndrome	KEGG:H01884
Auriculocondylar syndrome	KEGG:H01884
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray