• Gene id: 2771

Gene Summary

• Gene Symbol: GNAI2   Gene   UCSC   Ensembl
• Aliases: GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1
• Gene name: G protein subunit alpha i2
• Alternate names: guanine nucleotide-binding protein G(i) subunit alpha-2, GTP-binding regulatory protein Gi alpha-2 chain, adenylate cyclase-inhibiting G alpha protein, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2, guanine nucleotide,
• Gene location: 3p21.31 (50227067: 50259361)     Exons: 13     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript
• OMIM: 139360

Protein Summary

• Protein general information: P04899  
  • Name: Guanine nucleotide binding protein G(i) subunit alpha 2 (Adenylate cyclase inhibiting G alpha protein)
  • Length: 355  
  • Mass: 40451
• Sequence:

  MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYS
  NTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLN
  DSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFC
  VALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
  ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

• Structural information:
  • Protein Domains: (32..35-)
    (/note="G-alpha-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01230"-)
  • Interpro: IPR001408  IPR001019  IPR011025  IPR027417  
  • Prosite: PS51882
  • CDD: cd00066
  • PDB: 6D9H
  • PDBsum: 6D9H
  • DIP: 602
  • STRING: ENSP00000312999
• Other Databases: GeneCards:  GNAI2  Malacards:  GNAI2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031683	G-protein beta/gamma-subunit complex binding	IBA	molecular function
GO:0007214	gamma-aminobutyric acid signaling pathway	IBA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005834	heterotrimeric G-protein complex	IBA	cellular component
GO:0001973	G protein-coupled adenosine receptor signaling pathway	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0001664	G protein-coupled receptor binding	IBA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051301	cell division	IMP	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0019001	guanyl nucleotide binding	IEA	molecular function
GO:0031683	G-protein beta/gamma-subunit complex binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007194	negative regulation of adenylate cyclase activity	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007584	response to nutrient	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0006457	protein folding	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000179	positive regulation of neural precursor cell proliferation	IEA	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IEA	biological process
GO:0051924	regulation of calcium ion transport	IEA	biological process
GO:0045955	negative regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0033864	positive regulation of NAD(P)H oxidase activity	IEA	biological process
GO:0032930	positive regulation of superoxide anion generation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:1903614	negative regulation of protein tyrosine phosphatase activity	IEA	biological process
GO:0140199	negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway involved in heart process	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0050805	negative regulation of synaptic transmission	IEA	biological process
GO:0046628	positive regulation of insulin receptor signaling pathway	IEA	biological process
GO:0035815	positive regulation of renal sodium excretion	IEA	biological process
GO:0035810	positive regulation of urine volume	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007214	gamma-aminobutyric acid signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001973	G protein-coupled adenosine receptor signaling pathway	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1903561	extracellular vesicle	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05012	Parkinson disease
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05034	Alcoholism
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa04022	cGMP-PKG signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04728	Dopaminergic synapse
hsa04724	Glutamatergic synapse
hsa04611	Platelet activation
hsa04926	Relaxin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04670	Leukocyte transendothelial migration
hsa04935	Growth hormone synthesis, secretion and action
hsa04915	Estrogen signaling pathway
hsa04726	Serotonergic synapse
hsa04916	Melanogenesis
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa05145	Toxoplasmosis
hsa04914	Progesterone-mediated oocyte maturation
hsa05142	Chagas disease
hsa04540	Gap junction
hsa04971	Gastric acid secretion
hsa04924	Renin secretion
hsa05133	Pertussis
hsa05030	Cocaine addiction
hsa04730	Long-term depression
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Adrenal carcinoma	KEGG:H00033
Familial ventricular tachycardia	KEGG:H02269
Adrenal carcinoma	KEGG:H00033
Familial ventricular tachycardia	KEGG:H02269
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq