• Gene id: 2770

Gene Summary

• Gene Symbol: GNAI1   Gene   UCSC   Ensembl
• Aliases: Gi
• Gene name: G protein subunit alpha i1
• Alternate names: guanine nucleotide-binding protein G(i) subunit alpha-1, Gi1 protein alpha subunit, adenylate cyclase-inhibiting G alpha protein, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1,
• Gene location: 7q21.11 (1003236: 1057553)     Exons: 9     NC_000009.12
• Gene summary(Entrez): Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The alpha subunit binds guanine nucleotide, can hydrolyze GTP, and can interact with other proteins. The protein encoded by
• OMIM: 139310

Protein Summary

• Protein general information: P63096  
  • Name: Guanine nucleotide binding protein G(i) subunit alpha 1 (Adenylate cyclase inhibiting G alpha protein)
  • Length: 354  
  • Mass: 40,361
• Sequence:

  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYS
  NTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLND
  SAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCV
  ALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
  AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF

• Structural information:
  • Interpro: IPR001408  IPR001019  IPR011025  IPR027417  
  • CDD: cd00066
  • PDB: 1KJY 1Y3A 2G83 2GTP 2IK8 2OM2 2XNS 3ONW 3QE0 3QI2 3UMR 3UMS 4G5Q 5JS7 5JS8 5TDH
  • PDBsum: 1KJY 1Y3A 2G83 2GTP 2IK8 2OM2 2XNS 3ONW 3QE0 3QI2 3UMR 3UMS 4G5Q 5JS7 5JS8 5TDH
  • STRING: ENSP00000343027
• Other Databases: GeneCards:  GNAI1  Malacards:  GNAI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0001664	G-protein coupled receptor binding	ISS	molecular function
GO:0003924	GTPase activity	ISS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0004871	signal transducer activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	ISS	molecular function
GO:0005525	GTP binding	ISS	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005834	heterotrimeric G-protein complex	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007193	adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway	TAS	biological process
GO:0019003	GDP binding	ISS	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0031683	G-protein beta/gamma-subunit complex binding	IBA	molecular function
GO:0031821	G-protein coupled serotonin receptor binding	IBA	molecular function
GO:0032794	GTPase activating protein binding	IEA	molecular function
GO:0043434	response to peptide hormone	ISS	biological process
GO:0043949	regulation of cAMP-mediated signaling	ISS	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0050805	negative regulation of synaptic transmission	IEA	biological process
GO:0051301	cell division	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1904322	cellular response to forskolin	ISS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0001664	G-protein coupled receptor binding	ISS	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0003924	GTPase activity	ISS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004871	signal transducer activity	IBA	molecular function
GO:0004871	signal transducer activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	ISS	molecular function
GO:0005525	GTP binding	ISS	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005834	heterotrimeric G-protein complex	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007193	adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019001	guanyl nucleotide binding	IEA	molecular function
GO:0019003	GDP binding	IEA	molecular function
GO:0019003	GDP binding	ISS	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0031683	G-protein beta/gamma-subunit complex binding	IEA	molecular function
GO:0031683	G-protein beta/gamma-subunit complex binding	IBA	molecular function
GO:0031821	G-protein coupled serotonin receptor binding	IEA	molecular function
GO:0031821	G-protein coupled serotonin receptor binding	IBA	molecular function
GO:0032794	GTPase activating protein binding	IEA	molecular function
GO:0043234	protein complex	IEA	cellular component
GO:0043434	response to peptide hormone	ISS	biological process
GO:0043949	regulation of cAMP-mediated signaling	ISS	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0050805	negative regulation of synaptic transmission	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051301	cell division	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1904322	cellular response to forskolin	ISS	biological process
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0001664	G-protein coupled receptor binding	ISS	molecular function
GO:0003924	GTPase activity	ISS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0004871	signal transducer activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	ISS	molecular function
GO:0005525	GTP binding	ISS	molecular function
GO:0005525	GTP binding	TAS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005834	heterotrimeric G-protein complex	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	ISS	biological process
GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007193	adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway	TAS	biological process
GO:0019003	GDP binding	ISS	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0031683	G-protein beta/gamma-subunit complex binding	IBA	molecular function
GO:0031821	G-protein coupled serotonin receptor binding	IBA	molecular function
GO:0043434	response to peptide hormone	ISS	biological process
GO:0043949	regulation of cAMP-mediated signaling	ISS	biological process
GO:0051301	cell division	IMP	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:1904322	cellular response to forskolin	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04071	Sphingolipid signaling pathway
hsa04024	cAMP signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04540	Gap junction
hsa04611	Platelet activation
hsa04670	Leukocyte transendothelial migration
hsa04062	Chemokine signaling pathway
hsa04923	Regulation of lipolysis in adipocytes
hsa04915	Estrogen signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa04921	Oxytocin signaling pathway
hsa04926	Relaxin signaling pathway
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04916	Melanogenesis
hsa04924	Renin secretion
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04971	Gastric acid secretion
hsa04724	Glutamatergic synapse
hsa04727	GABAergic synapse
hsa04725	Cholinergic synapse
hsa04728	Dopaminergic synapse
hsa04726	Serotonergic synapse
hsa04730	Long-term depression
hsa04723	Retrograde endocannabinoid signaling
hsa04360	Axon guidance
hsa04713	Circadian entrainment
hsa05200	Pathways in cancer
hsa05012	Parkinson disease
hsa05030	Cocaine addiction
hsa05032	Morphine addiction
hsa05034	Alcoholism
hsa04934	Cushing syndrome
hsa05133	Pertussis
hsa05170	Human immunodeficiency virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05145	Toxoplasmosis
hsa05142	Chagas disease

Diseases

Associated diseases	References
Bulimia	GAD: 20468064

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
8579477	Non-obstructive azoospermia			48 (15 vasectomized males, 7 azoospermics with obstruction)	Male infertility