• Gene id: 2766

Gene Summary

• Gene Symbol: GMPR   Gene   UCSC   Ensembl
• Aliases: GMPR 1, GMPR1
• Gene name: guanosine monophosphate reductase
• Alternate names: GMP reductase 1, guanine monophosphate reductase, guanosine 5'-monophosphate oxidoreductase 1, guanosine monophosphate reductase 1,
• Gene location: 6p22.3 (16238586: 16295548)     Exons: 10     NC_000006.12
• Gene summary(Entrez): This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.[provided by RefSeq, Oct 2009]
• OMIM: 179035

Protein Summary

• Protein general information: P36959  
  • Name: GMP reductase 1 (GMPR 1) (EC 1.7.1.7) (Guanosine 5' monophosphate oxidoreductase 1) (Guanosine monophosphate reductase 1)
  • Length: 345  
  • Mass: 37419
• Sequence:

  MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTA
  IHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFP
  EHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCP
  GDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGD
  VENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

• Structural information:
  • Interpro: IPR013785  IPR005993  IPR015875  IPR001093  
  • Prosite: PS00487
  • CDD: cd00381
  • PDB: 2BLE 2BWG
  • PDBsum: 2BLE 2BWG
  • STRING: ENSP00000259727
• Other Databases: GeneCards:  GMPR  Malacards:  GMPR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015951	purine ribonucleotide interconversion	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0003920	GMP reductase activity	IBA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0003920	GMP reductase activity	IEA	molecular function
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:1902560	GMP reductase complex	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006144	purine nucleobase metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0003920	GMP reductase activity	TAS	molecular function
GO:0009409	response to cold	TAS	biological process
GO:0003920	GMP reductase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0043101	purine-containing compound salvage	TAS	biological process
GO:0006163	purine nucleotide metabolic process	IEA	biological process
GO:0003920	GMP reductase activity	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq