• Gene id: 2764

Gene Summary

• Gene Symbol: GMFB   Gene   UCSC   Ensembl
• Aliases: GMF
• Gene name: glia maturation factor beta
• Alternate names: glia maturation factor beta, GMF-beta,
• Gene location: 14q22.2 (54488979: 54474484)     Exons: 7     NC_000014.9
• OMIM: 607158

Protein Summary

• Protein general information: P60983  
  • Name: Glia maturation factor beta (GMF beta)
  • Length: 142  
  • Mass: 16713
• Sequence:

  MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKY
  QHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH

• Structural information:
  • Protein Domains: (4..13-)
    (/note="ADF-H-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00599"-)
  • Interpro: IPR002108  IPR029006  IPR011171  
  • Prosite: PS51263
  • CDD: cd11283
  • STRING: ENSP00000350757
• Other Databases: GeneCards:  GMFB  Malacards:  GMFB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0071846	actin filament debranching	IBA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0034316	negative regulation of Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0071933	Arp2/3 complex binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0004860	protein kinase inhibitor activity	TAS	molecular function
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881