• Gene id: 2745

Gene Summary

• Gene Symbol: GLRX   Gene   UCSC   Ensembl
• Aliases: GRX, GRX1
• Gene name: glutaredoxin
• Alternate names: glutaredoxin-1, TTase-1, thioltransferase, thioltransferase-1,
• Gene location: 5q15 (95822872: 95813848)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial
• OMIM: 601271

Protein Summary

• Protein general information: P35754  
  • Name: Glutaredoxin 1 (Thioltransferase 1) (TTase 1)
  • Length: 106  
  • Mass: 11776
• Sequence:

  MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFI
  GKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

• Structural information:
  • Protein Domains: (3..10-)
    (/note="Glutaredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00686"-)
  • Interpro: IPR011767  IPR002109  IPR011899  IPR014025  IPR036249  
  • Prosite: PS00195 PS51354
  • PDB: 1B4Q 1JHB 4RQR
  • PDBsum: 1B4Q 1JHB 4RQR
  • STRING: ENSP00000369314
• Other Databases: GeneCards:  GLRX  Malacards:  GLRX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0009055	electron transfer activity	IEA	molecular function
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015038	glutathione disulfide oxidoreductase activity	TAS	molecular function
GO:0015038	glutathione disulfide oxidoreductase activity	EXP	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:2000651	positive regulation of sodium ion transmembrane transporter activity	IDA	biological process
GO:0045838	positive regulation of membrane potential	IDA	biological process
GO:0097573	glutathione oxidoreductase activity	TAS	molecular function
GO:0080058	protein deglutathionylation	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0022900	electron transport chain	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881