• Gene id: 2744

Gene Summary

• Gene Symbol: GLS   Gene   UCSC   Ensembl
• Aliases: AAD20, CASGID, EIEE71, GAC, GAM, GDPAG, GLS1, KGA
• Gene name: glutaminase
• Alternate names: glutaminase kidney isoform, mitochondrial, K-glutaminase, L-glutamine amidohydrolase, glutaminase C, glutaminase, phosphate-activated,
• Gene location: 2q32.2 (190880820: 190965551)     Exons: 20     NC_000002.12
• Gene summary(Entrez): This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an
• OMIM: 607059

Protein Summary

• Protein general information: O94925  
  • Name: Glutaminase kidney isoform, mitochondrial (GLS) (EC 3.5.1.2) (K glutaminase) (L glutamine amidohydrolase) [Cleaved into: Glutaminase kidney isoform, mitochondrial 68 kDa chain; Glutaminase kidney isoform, mitochondrial 65 kDa chain]
  • Length: 669  
  • Mass: 73461
  • Tissue specificity: Isoform 1 and isoform 3 are detected in brain cortex. Isoform 3 is highly expressed in astrocytoma, ganglioglioma and ependymoma. Isoform 1 is highly expressed in brain and kidney, but not detected in liver. Isoform 3 is highly express
• Sequence:

  MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSS
  PSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIKQGLLPSLEDLLFYTIAEG
  QEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFM
  SFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDL
  GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSN
  ATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSP
  EAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLC
  NFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
  VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR012338  IPR015868   IPR041541  
  • Prosite: PS50297 PS50088
  • PDB: 3CZD 3UNW 3UO9 3VOY 3VOZ 3VP0 3VP1 3VP2 3VP3 3VP4 4O7D 5D3O 5FI2 5FI6 5FI7 5HL1 5I94 5JYO 5JYP 5U0I 5U0J 5UQE 5WJ6
  • PDBsum: 3CZD 3UNW 3UO9 3VOY 3VOZ 3VP0 3VP1 3VP2 3VP3 3VP4 4O7D 5D3O 5FI2 5FI6 5FI7 5HL1 5I94 5JYO 5JYP 5U0I 5U0J 5UQE 5WJ6
  • DIP: 50591
  • STRING: ENSP00000317379
• Other Databases: GeneCards:  GLS  Malacards:  GLS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004359	glutaminase activity	IBA	molecular function
GO:0006537	glutamate biosynthetic process	IBA	biological process
GO:0006543	glutamine catabolic process	IBA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:0006543	glutamine catabolic process	IDA	biological process
GO:0006537	glutamate biosynthetic process	IDA	biological process
GO:0006537	glutamate biosynthetic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0004359	glutaminase activity	IDA	molecular function
GO:0090461	glutamate homeostasis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004359	glutaminase activity	IEA	molecular function
GO:0006541	glutamine metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004359	glutaminase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0008652	cellular amino acid biosynthetic process	TAS	biological process
GO:0014047	glutamate secretion	TAS	biological process
GO:0051289	protein homotetramerization	IEA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0006543	glutamine catabolic process	IEA	biological process
GO:0006537	glutamate biosynthetic process	IEA	biological process
GO:0002087	regulation of respiratory gaseous exchange by nervous system process	IEA	biological process
GO:0004359	glutaminase activity	IEA	molecular function
GO:0001967	suckling behavior	IEA	biological process
GO:0006537	glutamate biosynthetic process	TAS	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005739	mitochondrion	NAS	cellular component
GO:0004359	glutaminase activity	NAS	molecular function
GO:0006543	glutamine catabolic process	NAS	biological process
GO:0004359	glutaminase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05206	MicroRNAs in cancer
hsa04724	Glutamatergic synapse
hsa04727	GABAergic synapse
hsa05230	Central carbon metabolism in cancer
hsa00250	Alanine, aspartate and glutamate metabolism
hsa04964	Proximal tubule bicarbonate reclamation
hsa00220	Arginine biosynthesis
hsa00471	D-Glutamine and D-glutamate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881