• Gene id: 27430

Gene Summary

• Gene Symbol: MAT2B   Gene   UCSC   Ensembl
• Aliases: MAT-II, MATIIbeta, Nbla02999, SDR23E1, TGR
• Gene name: methionine adenosyltransferase 2B
• Alternate names: methionine adenosyltransferase 2 subunit beta, MAT II beta, beta regulatory subunit of methionine adenosyltransferase, dTDP-4-keto-6-deoxy-D-glucose 4-reductase, methionine adenosyltransferase II, beta, putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase, putati,
• Gene location: 5q34 (163503063: 163519353)     Exons: 8     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT. Alternative splicing results i
• OMIM: 605527

Protein Summary

• Protein general information: Q9NZL9  
  • Name: Methionine adenosyltransferase 2 subunit beta (Methionine adenosyltransferase II beta) (MAT II beta) (Putative dTDP 4 keto 6 deoxy D glucose 4 reductase)
  • Length: 334  
  • Mass: 37552
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDS
  NAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREE
  DIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVK
  DVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKL
  ETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH

• Structural information:
  • Interpro: IPR005913  IPR036291  IPR029903  
  • PDB: 2YDX 2YDY 4KTT 4KTV 4NDN
  • PDBsum: 2YDX 2YDY 4KTT 4KTV 4NDN
  • STRING: ENSP00000325425
• Other Databases: GeneCards:  MAT2B  Malacards:  MAT2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048270	methionine adenosyltransferase regulator activity	IBA	molecular function
GO:0048269	methionine adenosyltransferase complex	IBA	cellular component
GO:0006556	S-adenosylmethionine biosynthetic process	IBA	biological process
GO:0048269	methionine adenosyltransferase complex	IDA	cellular component
GO:0048270	methionine adenosyltransferase regulator activity	IDA	molecular function
GO:0006556	S-adenosylmethionine biosynthetic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006730	one-carbon metabolic process	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0032259	methylation	TAS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0006556	S-adenosylmethionine biosynthetic process	IEA	biological process
GO:0048270	methionine adenosyltransferase regulator activity	IDA	molecular function
GO:0048269	methionine adenosyltransferase complex	IDA	cellular component
GO:0006556	S-adenosylmethionine biosynthetic process	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01230	Biosynthesis of amino acids
hsa00270	Cysteine and methionine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray