• Gene id: 2740

Gene Summary

• Gene Symbol: GLP1R   Gene   UCSC   Ensembl
• Aliases: GLP-1, GLP-1-R, GLP-1R
• Gene name: glucagon like peptide 1 receptor
• Alternate names: glucagon-like peptide 1 receptor, GLP-1 receptor, GLP1 receptor, seven transmembrane helix receptor,
• Gene location: 6p21.2 (39048780: 39091302)     Exons: 12     NC_000006.12
• Gene summary(Entrez): This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response
• OMIM: 138032

Protein Summary

• Protein general information: P43220  
  • Name: Glucagon like peptide 1 receptor (GLP 1 receptor) (GLP 1 R) (GLP 1R)
  • Length: 463  
  • Mass: 53026
• Sequence:

  MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDG
  EPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLYIIYTV
  GYALSFSALVIASAILLGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLS
  CRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
  SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHA
  RGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERWRLEHLHIQRDSSMKPLKCPTSSLSSGATAG
  SSMYTATCQASCS

• Structural information:
  • Interpro: IPR017981  IPR036445  IPR001879  IPR003290  IPR003292   IPR000832  IPR017983  
  • Prosite: PS00649 PS00650 PS50227 PS50261
  • PDB: 3C59 3C5T 3IOL 4ZGM 5E94 5NX2 5OTT 5OTU 5OTV 5OTW 5OTX 5VEW 5VEX 6B3J 6GB1 6ORV
  • PDBsum: 3C59 3C5T 3IOL 4ZGM 5E94 5NX2 5OTT 5OTU 5OTV 5OTW 5OTX 5VEW 5VEX 6B3J 6GB1 6ORV
  • DIP: 29980
  • STRING: ENSP00000362353
• Other Databases: GeneCards:  GLP1R  Malacards:  GLP1R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045777	positive regulation of blood pressure	IBA	biological process
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0044508	glucagon-like peptide 1 receptor activity	IBA	molecular function
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0044508	glucagon-like peptide 1 receptor activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0004967	glucagon receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007190	activation of adenylate cyclase activity	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0050796	regulation of insulin secretion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990911	response to psychosocial stress	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0008016	regulation of heart contraction	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0071377	cellular response to glucagon stimulus	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0019933	cAMP-mediated signaling	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04911	Insulin secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)