• Gene id: 2739

Gene Summary

• Gene Symbol: GLO1   Gene   UCSC   Ensembl
• Aliases: GLOD1, GLYI, HEL-S-74
• Gene name: glyoxalase I
• Alternate names: lactoylglutathione lyase, S-D-lactoylglutathione methylglyoxal lyase, aldoketomutase, epididymis secretory protein Li 74, glx I, glyoxalase domain containing 1, ketone-aldehyde mutase, lactoyl glutathione lyase, methylglyoxalase,
• Gene location: 6p21.2 (73498424: 73505622)     Exons: 6     NC_000005.10
• Gene summary(Entrez): The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere
• OMIM: 138750

Protein Summary

• Protein general information: Q04760  
  • Name: Lactoylglutathione lyase (EC 4.4.1.5) (Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone aldehyde mutase) (Methylglyoxalase) (S D lactoylglutathione methylglyoxal lyase)
  • Length: 184  
  • Mass: 20778
• Sequence:

  MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAY
  EDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFV
  KKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

• Structural information:
  • Protein Domains: (31..17-)
    (/note="VOC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01163"-)
  • Interpro: IPR029068  IPR004360  IPR004361  IPR018146  IPR037523  
  • Prosite: PS00934 PS00935 PS51819
  • PDB: 1BH5 1FRO 1QIN 1QIP 3VW9 3W0T 3W0U
  • PDBsum: 1BH5 1FRO 1QIN 1QIP 3VW9 3W0T 3W0U
  • STRING: ENSP00000362463
• Other Databases: GeneCards:  GLO1  Malacards:  GLO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IDA	molecular function
GO:0004462	lactoylglutathione lyase activity	IDA	molecular function
GO:0030316	osteoclast differentiation	ISS	biological process
GO:0004462	lactoylglutathione lyase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004462	lactoylglutathione lyase activity	TAS	molecular function
GO:0005975	carbohydrate metabolic process	NAS	biological process
GO:0004462	lactoylglutathione lyase activity	IEA	molecular function
GO:0006090	pyruvate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0009438	methylglyoxal metabolic process	IEA	biological process
GO:0006749	glutathione metabolic process	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0004462	lactoylglutathione lyase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0004462	lactoylglutathione lyase activity	IEA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0004462	lactoylglutathione lyase activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00620	Pyruvate metabolism

Diseases

Associated diseases	References
autistic disorder	PMID:17346350
Vascular disease	PMID:18079478
Diabetic retinopathy	PMID:21738003
type 2 diabetes mellitus	PMID:18413187
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881