• Gene id: 27350

Gene Summary

• Gene Symbol: APOBEC3C   Gene   UCSC   Ensembl
• Aliases: A3C, APOBEC1L, ARDC2, ARDC4, ARP5, PBI, bK150C2.3
• Gene name: apolipoprotein B mRNA editing enzyme catalytic subunit 3C
• Alternate names: DNA dC->dU-editing enzyme APOBEC-3C, apolipoprotein B editing enzyme catalytic polypeptide-like 3C, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C, phorbolin I, probable DNA dC->dU-editing enzyme APOBEC-3C,
• Gene location: 22q13.1 (39014235: 39020351)     Exons: 3     NC_000022.11
• Gene summary(Entrez): This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and fun
• OMIM: 610322

Protein Summary

• Protein general information: Q9NRW3  
  • Name: DNA dC >dU editing enzyme APOBEC 3C (A3C) (EC 3.5.4.38) (APOBEC1 like) (Phorbolin I)
  • Length: 190  
  • Mass: 22826
  • Tissue specificity: Expressed in spleen, testes, peripherical blood lymphocytes, heart, thymus, prostate and ovary. {ECO
• Sequence:

  MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERCFLSWF
  CDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDY
  EDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ

• Structural information:
  • Protein Domains: (29..13-)
    (/note="CMP/dCMP-type-deaminase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01083"-)
  • Interpro: IPR016192  IPR002125  IPR016193  
  • Prosite: PS00903 PS51747
  • PDB: 3VM8 3VOW
  • PDBsum: 3VM8 3VOW
  • DIP: 48919
  • STRING: ENSP00000355340
• Other Databases: GeneCards:  APOBEC3C  Malacards:  APOBEC3C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IBA	biological process
GO:0010529	negative regulation of transposition	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0080111	DNA demethylation	IBA	biological process
GO:0070383	DNA cytosine deamination	IBA	biological process
GO:0047844	deoxycytidine deaminase activity	IBA	molecular function
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IBA	biological process
GO:0016554	cytidine to uridine editing	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004126	cytidine deaminase activity	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0010529	negative regulation of transposition	IDA	biological process
GO:0010529	negative regulation of transposition	IDA	biological process
GO:0080111	DNA demethylation	IDA	biological process
GO:0009972	cytidine deamination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0051607	defense response to virus	IBA	biological process
GO:0010529	negative regulation of transposition	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0080111	DNA demethylation	IBA	biological process
GO:0070383	DNA cytosine deamination	IBA	biological process
GO:0047844	deoxycytidine deaminase activity	IBA	molecular function
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IBA	biological process
GO:0016554	cytidine to uridine editing	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004126	cytidine deaminase activity	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0010529	negative regulation of transposition	IDA	biological process
GO:0010529	negative regulation of transposition	IDA	biological process
GO:0080111	DNA demethylation	IDA	biological process
GO:0009972	cytidine deamination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R