• Gene id: 27349

Gene Summary

• Gene Symbol: MCAT   Gene   UCSC   Ensembl
• Aliases: FASN2C, MCT, MCT1, MT, NET62, fabD
• Gene name: malonyl-CoA-acyl carrier protein transacylase
• Alternate names: malonyl-CoA-acyl carrier protein transacylase, mitochondrial, [Acyl-carrier-protein] malonyltransferase, [acyl-carrier-protein] S-malonyltransferase, malonyl CoA:ACP acyltransferase (mitochondrial), mitochondrial malonyl CoA:ACP acyltransferase, mitochondrial ,
• Gene location: 22q13.2 (27672228: 27666060)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex tha
• OMIM: 614479

Protein Summary

• Protein general information: Q8IVS2  
  • Name: Malonyl CoA acyl carrier protein transacylase, mitochondrial (MCT) (EC 2.3.1.39) (Mitochondrial malonyl CoA:ACP acyltransferase) (Mitochondrial malonyltransferase) ([Acyl carrier protein] malonyltransferase)
  • Length: 390  
  • Mass: 42962
• Sequence:

  MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVV
  GMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAA
  GFSVGEFAALVFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVC
  EVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSN
  VHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVL
  QTLEHVDLDPQEPPR

• Structural information:
  • Interpro: IPR001227  IPR014043  IPR016035  IPR016036  IPR020801  
  • PDB: 2C2N
  • PDBsum: 2C2N
  • STRING: ENSP00000290429
• Other Databases: GeneCards:  MCAT  Malacards:  MCAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004314	[acyl-carrier-protein] S-malonyltransferase activity	IBA	molecular function
GO:0006633	fatty acid biosynthetic process	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004314	[acyl-carrier-protein] S-malonyltransferase activity	IEA	molecular function
GO:0016419	S-malonyltransferase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0004314	[acyl-carrier-protein] S-malonyltransferase activity	TAS	molecular function
GO:0006635	fatty acid beta-oxidation	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0004312	fatty acid synthase activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0006633	fatty acid biosynthetic process	IDA	biological process
GO:0004314	[acyl-carrier-protein] S-malonyltransferase activity	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01212	Fatty acid metabolism
hsa00061	Fatty acid biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881