• Gene id: 27345

Gene Summary

• Gene Symbol: KCNMB4   Gene   UCSC   Ensembl
• Gene name: potassium calcium-activated channel subfamily M regulatory beta subunit 4
• Alternate names: calcium-activated potassium channel subunit beta-4, BK channel beta subunit 4, BK channel subunit beta-4, BKbeta4, MaxiK channel beta-subunit 4, big potassium channel beta subunit 4, calcium-activated potassium channel, subfamily M subunit beta-4, charybdotoxin ,
• Gene location: 12q15 (70366219: 70434291)     Exons: 5     NC_000012.12
• Gene summary(Entrez): MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the
• OMIM: 600239

Protein Summary

• Protein general information: Q86W47  
  • Name: Calcium activated potassium channel subunit beta 4 (BK channel subunit beta 4) (BKbeta4) (Hbeta4) (Calcium activated potassium channel, subfamily M subunit beta 4) (Charybdotoxin receptor subunit beta 4) (K(VCA)beta 4) (Maxi K channel subunit beta 4) (Slo
  • Length: 210  
  • Mass: 23949
  • Tissue specificity: Predominantly expressed in brain. In brain, it is expressed in the cerebellum, cerebral cortex, medulla, spinal cord, occipital pole, frontal lobe, temporal lobe, putamen, amygdala, caudate nucleus, corpus callosum, hippocampus, substa
• Sequence:

  MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGAD
  CRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDEIGSQPFTCYF
  NQHQRPDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVKAEAMKKRKFS

• Structural information:
  • Interpro: IPR003930  
  • PDB: 5Y7L 6V22 6V35
  • PDBsum: 5Y7L 6V22 6V35
  • STRING: ENSP00000258111
• Other Databases: GeneCards:  KCNMB4  Malacards:  KCNMB4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0015269	calcium-activated potassium channel activity	IBA	molecular function
GO:0015459	potassium channel regulator activity	IBA	molecular function
GO:0005513	detection of calcium ion	IBA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0015269	calcium-activated potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015269	calcium-activated potassium channel activity	IEA	molecular function
GO:0008076	voltage-gated potassium channel complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0015269	calcium-activated potassium channel activity	IDA	molecular function
GO:0006813	potassium ion transport	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0019228	neuronal action potential	IDA	biological process
GO:0001508	action potential	IDA	biological process
GO:0005513	detection of calcium ion	IDA	biological process
GO:0019229	regulation of vasoconstriction	TAS	biological process
GO:0046928	regulation of neurotransmitter secretion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04022	cGMP-PKG signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa04911	Insulin secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq