• Gene id: 27338

Gene Summary

• Gene Symbol: UBE2S   Gene   UCSC   Ensembl
• Aliases: E2-EPF, E2EPF, EPF5
• Gene name: ubiquitin conjugating enzyme E2 S
• Alternate names: ubiquitin-conjugating enzyme E2 S, E2 ubiquitin-conjugating enzyme S, E2-EPF5, ubiquitin carrier protein S, ubiquitin conjugating enzyme E2S, ubiquitin-conjugating enzyme E2-24 kD, ubiquitin-conjugating enzyme E2-24 kDa, ubiquitin-conjugating enzyme E2-EPF5, ubiq,
• Gene location: 19q13.42 (55408438: 55399744)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. [pr
• OMIM: 605450

Protein Summary

• Protein general information: Q16763  
  • Name: Ubiquitin conjugating enzyme E2 S (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme S) (E2 EPF) (Ubiquitin carrier protein S) (Ubiquitin conjugating enzyme E2 24 kDa) (Ubiquitin conjugating enzyme E2 EPF5) (Ubiquitin protein ligase S)
  • Length: 222  
  • Mass: 23845
• Sequence:

  MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPP
  KGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARL
  LTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 1ZDN 5BNB 5L9T 6QH3 6QHK
  • PDBsum: 1ZDN 5BNB 5L9T 6QH3 6QHK
  • DIP: 52784
  • STRING: ENSP00000264552
• Other Databases: GeneCards:  UBE2S  Malacards:  UBE2S

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:1904668	positive regulation of ubiquitin protein ligase activity	IDA	biological process
GO:1904668	positive regulation of ubiquitin protein ligase activity	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:0031145	anaphase-promoting complex-dependent catabolic process	IDA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	IDA	biological process
GO:0010994	free ubiquitin chain polymerization	IDA	biological process
GO:0010458	exit from mitosis	IDA	biological process
GO:0010997	anaphase-promoting complex binding	IPI	molecular function
GO:0010458	exit from mitosis	IMP	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0044314	protein K27-linked ubiquitination	IDA	biological process
GO:0035519	protein K29-linked ubiquitination	IDA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0070534	protein K63-linked ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0085020	protein K6-linked ubiquitination	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray