About Us

Search Result


Gene id 27335
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol EIF3K   Gene   UCSC   Ensembl
Aliases ARG134, EIF3-p28, EIF3S12, HSPC029, M9, MSTP001, PLAC-24, PLAC24, PRO1474, PTD001
Gene name eukaryotic translation initiation factor 3 subunit K
Alternate names eukaryotic translation initiation factor 3 subunit K, eIF-3 p28, eukaryotic translation initiation factor 3, subunit 12, muscle specific, muscle-specific gene M9 protein,
Gene location 19q13.2 (27807989: 27823013)     Exons: 3     NC_000023.11
Gene summary(Entrez) The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of t
OMIM 609596

Protein Summary

Protein general information Q9UBQ5  

Name: Eukaryotic translation initiation factor 3 subunit K (eIF3k) (Eukaryotic translation initiation factor 3 subunit 12) (Muscle specific gene M9 protein) (PLAC 24) (eIF 3 p25) (eIF 3 p28)

Length: 218  Mass: 25060

Tissue specificity: Ubiquitous, with the highest levels of expression in brain, testis and kidney. {ECO

Sequence MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALT
NLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITY
QHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Structural information
Protein Domains
(42..20-)
(/note="PCI-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
Interpro:  IPR016024  IPR033464  IPR009374  IPR000717  IPR016020  
IPR036388  IPR036390  
Prosite:   PS50250

PDB:  
1RZ4 3J8B 3J8C 6FEC
PDBsum:   1RZ4 3J8B 3J8C 6FEC

DIP:  

32880

MINT:  
STRING:   ENSP00000248342
Other Databases GeneCards:  EIF3K  Malacards:  EIF3K

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IBA cellular component
GO:0003743 translation initiation fa
ctor activity
IBA contributes to
GO:0003743 translation initiation fa
ctor activity
IDA contributes to
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006446 regulation of translation
al initiation
IEA biological process
GO:0043022 ribosome binding
IEA molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IEA cellular component
GO:0006412 translation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0006413 translational initiation
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0006413 translational initiation
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006413 translational initiation
IEA biological process
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0016282 eukaryotic 43S preinitiat
ion complex
IEA cellular component
GO:0002183 cytoplasmic translational
initiation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0033290 eukaryotic 48S preinitiat
ion complex
IEA cellular component
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0001732 formation of cytoplasmic
translation initiation co
mplex
IEA biological process
GO:0003723 RNA binding
IEA molecular function
GO:0003743 translation initiation fa
ctor activity
IC contributes to
GO:0006413 translational initiation
IC biological process
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0003743 translation initiation fa
ctor activity
IDA contributes to
GO:0003743 translation initiation fa
ctor activity
IC contributes to
GO:0006413 translational initiation
IDA biological process
GO:0006413 translational initiation
IC biological process
GO:0005852 eukaryotic translation in
itiation factor 3 complex
IDA cellular component
GO:0016020 membrane
HDA cellular component
Associated diseases References
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract