• Gene id: 27329

Gene Summary

• Gene Symbol: ANGPTL3   Gene   UCSC   Ensembl
• Aliases: ANG-5, ANGPT5, ANL3, FHBL2
• Gene name: angiopoietin like 3
• Alternate names: angiopoietin-related protein 3, angiopoietin 5,
• Gene location: 1p31.3 (62597519: 62606312)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fib
• OMIM: 604774

Protein Summary

• Protein general information: Q9Y5C1  
  • Name: Angiopoietin related protein 3 (Angiopoietin 5) (ANG 5) (Angiopoietin like protein 3) [Cleaved into: ANGPTL3(17 221); ANGPTL3(17 224)]
  • Length: 460  
  • Mass: 53637
  • Tissue specificity: Expressed principally in liver. Weakly expressed in kidney. Binds to adipocytes. Increased expression and colocalization with activated ITGB3 in glomeruli of patients with nephrotic syndrome showing effaced podocyte foot processes (at
• Sequence:

  MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKL
  NIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQ
  NQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRT
  TPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWE
  NYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPE
  NKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKML
  IHPTDSESFE

• Structural information:
  • Protein Domains: (237..45-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR036056  IPR002181  
  • Prosite: PS51406
  • CDD: cd00087
  • PDB: 6EUA
  • PDBsum: 6EUA
  • STRING: ENSP00000360170
• Other Databases: GeneCards:  ANGPTL3  Malacards:  ANGPTL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0009395	phospholipid catabolic process	IBA	biological process
GO:0042632	cholesterol homeostasis	IBA	biological process
GO:0055091	phospholipid homeostasis	IBA	biological process
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0070328	triglyceride homeostasis	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0010519	negative regulation of phospholipase activity	IBA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0070328	triglyceride homeostasis	IGI	biological process
GO:0051004	regulation of lipoprotein lipase activity	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0070328	triglyceride homeostasis	IEA	biological process
GO:0055091	phospholipid homeostasis	IEA	biological process
GO:0055090	acylglycerol homeostasis	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0009725	response to hormone	IEA	biological process
GO:0048844	artery morphogenesis	IEA	biological process
GO:0010519	negative regulation of phospholipase activity	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0004859	phospholipase inhibitor activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0006071	glycerol metabolic process	IDA	biological process
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0009395	phospholipid catabolic process	IDA	biological process
GO:0042632	cholesterol homeostasis	IDA	biological process
GO:0051005	negative regulation of lipoprotein lipase activity	IDA	biological process
GO:0051005	negative regulation of lipoprotein lipase activity	IDA	biological process
GO:0055090	acylglycerol homeostasis	IDA	biological process
GO:0055091	phospholipid homeostasis	IDA	biological process
GO:0070328	triglyceride homeostasis	ISS	biological process
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0008203	cholesterol metabolic process	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010519	negative regulation of phospholipase activity	IDA	biological process
GO:0019915	lipid storage	IDA	biological process
GO:0050996	positive regulation of lipid catabolic process	IDA	biological process
GO:0055088	lipid homeostasis	IDA	biological process
GO:0048844	artery morphogenesis	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	NAS	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0007160	cell-matrix adhesion	IPI	biological process
GO:0004857	enzyme inhibitor activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
Familial hypobetalipoproteinemia	KEGG:H01270
Familial hypobetalipoproteinemia	KEGG:H01270
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)