• Gene id: 27316

Gene Summary

• Gene Symbol: RBMX   Gene   UCSC   Ensembl
• Aliases: HNRNPG, HNRPG, MRXS11, RBMXP1, RBMXRT, RNMX, hnRNP-G
• Gene name: RNA binding motif protein, X-linked
• Alternate names: RNA-binding motif protein, X chromosome, glycoprotein p43, heterogeneous nuclear ribonucleoprotein G, hnRNP G,
• Gene location: Xq26.3 (136880779: 136869193)     Exons: 11     NC_000023.11
• Gene summary(Entrez): This gene belongs to the RBMY gene family which includes candidate Y chromosome spermatogenesis genes. This gene, an active X chromosome homolog of the Y chromosome RBMY gene, is widely expressed whereas the RBMY gene evolved a male-specific function in s
• OMIM: 300199

Protein Summary

• Protein general information: P38159  
  • Name: RNA binding motif protein, X chromosome (Glycoprotein p43) (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) [Cleaved into: RNA binding motif protein, X chromosome, N terminally processed]
  • Length: 391  
  • Mass: 42,332
• Sequence:

  MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLD
  GKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVK
  RGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDY
  PSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGP
  PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGG
  GRGGSRSDRGGGRSRY

• Structural information:
  • Protein Domains: RRM. (8-86)
  • Interpro: IPR012677  IPR035979  IPR012604  IPR000504  IPR003954  
  • Prosite: PS50102
  • PDB: 2MB0 2MKS
  • PDBsum: 2MB0 2MKS
  • DIP: 34447
  • STRING: ENSP00000359645
• Other Databases: GeneCards:  RBMX  Malacards:  RBMX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0001047	core promoter binding	IDA	molecular function
GO:0001649	osteoblast differentiation	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0003723	RNA binding	NAS	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005719	nuclear euchromatin	IDA	cellular component
GO:0006366	transcription from RNA polymerase II promoter	IDA	biological process
GO:0006509	membrane protein ectodomain proteolysis	IDA	biological process
GO:0010467	gene expression	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	NAS	cellular component
GO:0044530	supraspliceosomal complex	IDA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0048025	negative regulation of mRNA splicing, via spliceosome	ISS	biological process
GO:0048026	positive regulation of mRNA splicing, via spliceosome	ISS	biological process
GO:0051260	protein homooligomerization	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0071347	cellular response to interleukin-1	IDA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0001047	core promoter binding	IDA	molecular function
GO:0001649	osteoblast differentiation	IDA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0003723	RNA binding	NAS	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005719	nuclear euchromatin	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IDA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0006509	membrane protein ectodomain proteolysis	IDA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0010467	gene expression	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IEA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	NAS	cellular component
GO:0044530	supraspliceosomal complex	IDA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0048025	negative regulation of mRNA splicing, via spliceosome	ISS	biological process
GO:0048026	positive regulation of mRNA splicing, via spliceosome	ISS	biological process
GO:0051260	protein homooligomerization	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0071347	cellular response to interleukin-1	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0001047	core promoter binding	IDA	molecular function
GO:0001649	osteoblast differentiation	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0003723	RNA binding	NAS	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0003729	mRNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005719	nuclear euchromatin	IDA	cellular component
GO:0006366	transcription from RNA polymerase II promoter	IDA	biological process
GO:0006509	membrane protein ectodomain proteolysis	IDA	biological process
GO:0010467	gene expression	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	NAS	cellular component
GO:0044530	supraspliceosomal complex	IDA	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0048025	negative regulation of mRNA splicing, via spliceosome	ISS	biological process
GO:0048026	positive regulation of mRNA splicing, via spliceosome	ISS	biological process
GO:0051260	protein homooligomerization	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0071347	cellular response to interleukin-1	IDA	biological process

Diseases

Associated diseases	References
Mental retardation	OMIM: 300199
Spermatogenesis defects	MIK: 14996998
Azoospermia	GAD: 16491274
Azoospermia	MIK: 16491274
Spermatogenic defects	MIK: 14996998
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
14996998	Impaired spermatogenesis	R100H, G388del		296 (153 subfertile men, 143 normozoospermic men)	Male infertility	HNRNP G-T
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
16491274	Azoospermia	deletion of SHGC31764	Japanes e	172 (NOA (n=67) and normal fertile volunteers (n=105))	Male infertility