• Gene id: 27304

Gene Summary

• Gene Symbol: MOCS3   Gene   UCSC   Ensembl
• Aliases: UBA4
• Gene name: molybdenum cofactor synthesis 3
• Alternate names: adenylyltransferase and sulfurtransferase MOCS3, MPT synthase sulfurylase, UBA4, ubiquitin-activating enzyme E1 homolog, molybdenum cofactor synthesis protein 3, molybdopterin synthase sulfurylase, ubiquitin-like modifier activating enzyme 4,
• Gene location: 20q13.13 (37231630: 37271364)     Exons: 14     NC_000002.12
• Gene summary(Entrez): Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of t
• OMIM: 609277

Protein Summary

• Protein general information: O95396  
  • Name: Adenylyltransferase and sulfurtransferase MOCS3 (Molybdenum cofactor synthesis protein 3) (Molybdopterin synthase sulfurylase) (MPT synthase sulfurylase) [Includes: Molybdopterin synthase adenylyltransferase (EC 2.7.7.80) (Adenylyltransferase MOCS3) (Sulf
  • Length: 460  
  • Mass: 49669
• Sequence:

  MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVH
  GQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNS
  AVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRC
  IFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAAC
  GERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPL
  KHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWA
  AKIDGTFPQY

• Structural information:
  • Protein Domains: (347..45-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03049"-)
  • Interpro: IPR028885  IPR001763  IPR036873  IPR000594  IPR035985  
  • Prosite: PS50206
  • PDB: 3I2V
  • PDBsum: 3I2V
  • DIP: 31168
  • STRING: ENSP00000244051
• Other Databases: GeneCards:  MOCS3  Malacards:  MOCS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016779	nucleotidyltransferase activity	IBA	molecular function
GO:0032446	protein modification by small protein conjugation	IBA	biological process
GO:0032447	protein urmylation	IBA	biological process
GO:0002143	tRNA wobble position uridine thiolation	IBA	biological process
GO:0004792	thiosulfate sulfurtransferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0042292	URM1 activating enzyme activity	IBA	molecular function
GO:0016783	sulfurtransferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0008641	ubiquitin-like modifier activating enzyme activity	IEA	molecular function
GO:0002143	tRNA wobble position uridine thiolation	IEA	biological process
GO:0004792	thiosulfate sulfurtransferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006777	Mo-molybdopterin cofactor biosynthetic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0061605	molybdopterin-synthase adenylyltransferase activity	IEA	molecular function
GO:0061604	molybdopterin-synthase sulfurtransferase activity	IEA	molecular function
GO:0032324	molybdopterin cofactor biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0034227	tRNA thio-modification	IEA	biological process
GO:0016783	sulfurtransferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006777	Mo-molybdopterin cofactor biosynthetic process	IEA	biological process
GO:0002098	tRNA wobble uridine modification	IEA	biological process
GO:0018192	enzyme active site formation via cysteine modification to L-cysteine persulfide	IEA	biological process
GO:0016779	nucleotidyltransferase activity	IDA	molecular function
GO:0006777	Mo-molybdopterin cofactor biosynthetic process	IDA	biological process
GO:0034227	tRNA thio-modification	IDA	biological process
GO:0016783	sulfurtransferase activity	IDA	molecular function
GO:0016783	sulfurtransferase activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0042292	URM1 activating enzyme activity	IDA	molecular function
GO:0018192	enzyme active site formation via cysteine modification to L-cysteine persulfide	IDA	biological process
GO:0002098	tRNA wobble uridine modification	IDA	biological process
GO:0004792	thiosulfate sulfurtransferase activity	IMP	molecular function
GO:0004792	thiosulfate sulfurtransferase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04122	Sulfur relay system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray