• Gene id: 27299

Gene Summary

• Gene Symbol: ADAMDEC1   Gene   UCSC   Ensembl
• Aliases: M12.219
• Gene name: ADAM like decysin 1
• Alternate names: ADAM DEC1, ADAM-like protein decysin-1, a disintegrin and metalloproteinase domain-like protein decysin-1, decysin, disintegrin protease,
• Gene location: 8p21.2 (24384284: 24406012)     Exons: 15     NC_000008.11
• Gene summary(Entrez): This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i
• OMIM: 606393

Protein Summary

• Protein general information: O15204  
  • Name: ADAM DEC1 (EC 3.4.24. ) (A disintegrin and metalloproteinase domain like protein decysin 1) (ADAM like protein decysin 1)
  • Length: 470  
  • Mass: 52775
  • Tissue specificity: Expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. Predominantly expressed in dendritic cells (DC) of the germinal center. Wea
• Sequence:

  MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEERYEPE
  VQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYF
  THHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLV
  LDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGK
  KIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCV
  MNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEAL
  TCKLKPGTDCGGDAPNHTTE

• Structural information:
  • Protein Domains: (218..41-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (420..47-)
    (/note="Disintegrin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00068"-)
  • Interpro: IPR033613  IPR001762  IPR036436  IPR024079  IPR001590   IPR002870  IPR034027  
  • Prosite: PS50215 PS50214 PS00142
  • CDD: cd04269
  • STRING: ENSP00000256412
• Other Databases: GeneCards:  ADAMDEC1  Malacards:  ADAMDEC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007162	negative regulation of cell adhesion	NAS	biological process
GO:0004222	metalloendopeptidase activity	NAS	molecular function
GO:0008270	zinc ion binding	NAS	molecular function
GO:0006955	immune response	NAS	biological process
GO:0004222	metalloendopeptidase activity	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)