• Gene id: 27297

Gene Summary

• Gene Symbol: CRCP   Gene   UCSC   Ensembl
• Aliases: C17, CGRP-RCP, CGRPRCP, POLR3I, POLR3J, RCP, RCP9, RPC9
• Gene name: CGRP receptor component
• Alternate names: DNA-directed RNA polymerase III subunit RPC9, CGRP-receptor component protein, RNA polymerase III subunit C9, calcitonin gene-related peptide-receptor component protein,
• Gene location: 7q11.21 (66114817: 66154567)     Exons: 7     NC_000007.14
• Gene summary(Entrez): This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided
• OMIM: 601248

Protein Summary

• Protein general information: O75575  
  • Name: DNA directed RNA polymerase III subunit RPC9 (RNA polymerase III subunit C9) (Calcitonin gene related peptide receptor component protein) (CGRP RCP) (CGRP receptor component protein) (CGRPRCP) (HsC17)
  • Length: 148  
  • Mass: 16871
  • Tissue specificity: Ubiquitous. Most prevalent in testis. {ECO
• Sequence:

  MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKS
  HKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

• Structural information:
  • Interpro: IPR010997  IPR006590  IPR005574  IPR038324  IPR038846  
  • STRING: ENSP00000378736
• Other Databases: GeneCards:  CRCP  Malacards:  CRCP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005623	obsolete cell	IDA	cellular component
GO:0005666	RNA polymerase III complex	IBA	cellular component
GO:0006384	transcription initiation from RNA polymerase III promoter	IBA	biological process
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005666	RNA polymerase III complex	IEA	cellular component
GO:0006384	transcription initiation from RNA polymerase III promoter	IEA	biological process
GO:0030880	RNA polymerase complex	IEA	cellular component
GO:0044237	cellular metabolic process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IEA	molecular function
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0001635	calcitonin gene-related peptide receptor activity	IEA	molecular function
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0009360	DNA polymerase III complex	IDA	cellular component
GO:0006383	transcription by RNA polymerase III	IDA	biological process
GO:0003899	DNA-directed 5'-3' RNA polymerase activity	IDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq