• Gene id: 27286

Gene Summary

• Gene Symbol: SRPX2   Gene   UCSC   Ensembl
• Aliases: BPP, CBPS, PMGX, RESDX, SRPUL
• Gene name: sushi repeat containing protein X-linked 2
• Alternate names: sushi repeat-containing protein SRPX2, sushi-repeat protein up-regulated in leukemia, sushi-repeat protein upregulated in leukemia,
• Gene location: Xq22.1 (71894407: 71931198)     Exons: 12     NC_000016.10
• Gene summary(Entrez): This gene encodes a secreted protein that contains three sushi repeat motifs. The encoded protein may play a role in the development of speech and language centers in the brain. This protein may also be involved in angiogenesis. Mutations in this gene are
• OMIM: 300642

Protein Summary

• Protein general information: O60687  
  • Name: Sushi repeat containing protein SRPX2 (Sushi repeat protein upregulated in leukemia)
  • Length: 465  
  • Mass: 52972
  • Tissue specificity: Expressed in neurons of the rolandic area of the brain (at protein level). Highly expressed in the brain, placenta, lung, trachea, uterus, adrenal gland, heart, ovary and placenta. Weakly expressed in the peripheral blood, brain and bo
• Sequence:

  MASQLTQRGALFLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPK
  GGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCS
  SGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRG
  PEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQG
  TPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRH
  VTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLS
  NQELTQRREQRDICE

• Structural information:
  • Protein Domains: (69..11-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (120..17-)
    (/note="Sushi-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (177..26-)
    (/note="HYR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00113-)
    (-)
  • Interpro: IPR025232  IPR003410  IPR028768  IPR035976  IPR000436  
  • Prosite: PS50825 PS50923
  • CDD: cd00033
  • STRING: ENSP00000362095
• Other Databases: GeneCards:  SRPX2  Malacards:  SRPX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048870	cell motility	IDA	biological process
GO:0098609	cell-cell adhesion	IDA	biological process
GO:0042325	regulation of phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0097060	synaptic membrane	IEA	cellular component
GO:0060076	excitatory synapse	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0071625	vocalization behavior	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0036458	hepatocyte growth factor binding	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0051965	positive regulation of synapse assembly	IDA	biological process
GO:0097060	synaptic membrane	ISS	cellular component
GO:0060076	excitatory synapse	ISS	cellular component
GO:0009986	cell surface	ISS	cellular component

Diseases

Associated diseases	References
Rolandic epilepsy, mental retardation, and speech dyspraxia	KEGG:H01827
Rolandic epilepsy, mental retardation, and speech dyspraxia	KEGG:H01827
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)