• Gene id: 27285

Gene Summary

• Gene Symbol: TEKT2   Gene   UCSC   Ensembl
• Aliases: TEKTB1, TEKTIN-T, h-tektin-t
• Gene name: tektin 2
• Alternate names: tektin-2, tektin 2 (testicular), tektin-B1, testicular tektin B1-like protein,
• Gene location: 1p34.3 (36084074: 36088274)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene product belongs to the tektin family of proteins. Tektins comprise a family of filament-forming proteins that are coassembled with tubulins to form ciliary and flagellar microtubules. This gene is expressed in the testis and its protein is local
• OMIM: 608953

Protein Summary

• Protein general information: Q9UIF3  
  • Name: Tektin 2 (Tektin t) (Testicular tektin) (Testicular tektin B1 like protein) (TEKTB1) (Tektin B1)
  • Length: 430  
  • Mass: 49,672
• Sequence:

  MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWK
  EMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKA
  LQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSRFN
  KDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHL
  EEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALCKHLARLQA
  DIACKANSMLLDTKCMDTRRKLTVPAERFVPEVDTFTRTTNSTLSPLKSCQLELA

• Structural information:
  • Interpro: IPR000435  
  • STRING: ENSP00000207457
• Other Databases: GeneCards:  TEKT2  Malacards:  TEKT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0036159	inner dynein arm assembly	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0031514	motile cilium	IEA	cellular component
GO:0036159	inner dynein arm assembly	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Non-syndromic asthenozoospermia	MIK: 18227105
Oligoasthenozoospermia	MIK: 23519396
Asthenozoospermia	MIK: 26584823
Cryptorchidism	MIK: 28606200
Asthenozoospermia	MIK: 26584823
Male infertility	MIK: 26584823
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Oligoasthenozoospermia	MIK: 23519396
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18227105	Non-syndromic asthenozoospermia	tektin-t (A229V)		90 isolated non-syndromic AZS patients	Male infertility	tektin-t
23519396	Oligoasthenozoospermic				Male infertility	CatSper 2 Tektin 2
26584823	Idiopathic asthenozoospermia, Male infertility	R207H (c.620G >A)	Chinese	206 (104 idiopathic asthenozoospermia, 102 fertile men)	Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray