• Gene id: 27284

Gene Summary

• Gene Symbol: SULT1B1   Gene   UCSC   Ensembl
• Aliases: ST1B1, ST1B2, SULT1B2
• Gene name: sulfotransferase family 1B member 1
• Alternate names: sulfotransferase family cytosolic 1B member 1, sulfotransferase 1B1, sulfotransferase 1B2, sulfotransferase family, cytosolic, 1B, member 1, thyroid hormone sulfotransferase,
• Gene location: 4q13.3 (69760643: 69721166)     Exons: 10     NC_000004.12
• Gene summary(Entrez): Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and
• OMIM: 603594

Protein Summary

• Protein general information: O43704  
  • Name: Sulfotransferase family cytosolic 1B member 1 (ST1B1) (Sulfotransferase 1B1) (EC 2.8.2. ) (Sulfotransferase 1B2) (ST1B2) (Thyroid hormone sulfotransferase)
  • Length: 296  
  • Mass: 34899
  • Tissue specificity: Highly expressed in the liver, peripheral blood leukocytes, colon (mucosal lining), small intestine (jejunum) and spleen. A lesser expression was observed in the lung, placenta and thymus. {ECO
• Sequence:

  MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFI
  TEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQ
  PFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRII
  HHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI

• Structural information:
  • Interpro: IPR027417  IPR000863  IPR033289  
  • PDB: 2Z5F 3CKL
  • PDBsum: 2Z5F 3CKL
  • STRING: ENSP00000308770
• Other Databases: GeneCards:  SULT1B1  Malacards:  SULT1B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006805	xenobiotic metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0042403	thyroid hormone metabolic process	IEA	biological process
GO:0051923	sulfation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008202	steroid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0006576	cellular biogenic amine metabolic process	TAS	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0051923	sulfation	IDA	biological process
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0004062	aryl sulfotransferase activity	IEA	molecular function
GO:0004062	aryl sulfotransferase activity	IEA	molecular function
GO:0051923	sulfation	IEA	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0009812	flavonoid metabolic process	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006068	ethanol catabolic process	IDA	biological process
GO:0004062	aryl sulfotransferase activity	IDA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0018958	phenol-containing compound metabolic process	IDA	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0042403	thyroid hormone metabolic process	IDA	biological process
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0005829	cytosol	NAS	cellular component
GO:0006805	xenobiotic metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0042403	thyroid hormone metabolic process	IEA	biological process
GO:0051923	sulfation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008202	steroid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008146	sulfotransferase activity	TAS	molecular function
GO:0006576	cellular biogenic amine metabolic process	TAS	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0051923	sulfation	IDA	biological process
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0004062	aryl sulfotransferase activity	IEA	molecular function
GO:0004062	aryl sulfotransferase activity	IEA	molecular function
GO:0051923	sulfation	IEA	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0009812	flavonoid metabolic process	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006068	ethanol catabolic process	IDA	biological process
GO:0004062	aryl sulfotransferase activity	IDA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0018958	phenol-containing compound metabolic process	IDA	biological process
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0042403	thyroid hormone metabolic process	IDA	biological process
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0005829	cytosol	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881