• Gene id: 27283

Gene Summary

• Gene Symbol: TINAG   Gene   UCSC   Ensembl
• Aliases: TIN-AG
• Gene name: tubulointerstitial nephritis antigen
• Alternate names: tubulointerstitial nephritis antigen,
• Gene location: 6p12.1 (54307791: 54390150)     Exons: 12     NC_000006.12
• Gene summary(Entrez): This gene encodes a glycoprotein that is restricted within the kidney to the basement membranes underlying the epithelium of Bowman's capsule and proximal and distal tubules. Autoantibodies against this protein are found in sera of patients with tubuloint
• OMIM: 606749

Protein Summary

• Protein general information: Q9UJW2  
  • Name: Tubulointerstitial nephritis antigen (TIN Ag)
  • Length: 476  
  • Mass: 54605
  • Tissue specificity: Expressed in the kidney cortex, small intestine and cornea. {ECO
• Sequence:

  MWTGYKILIFSYLTTEIWMEKQYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGCVTEFY
  AANALCYCDKFCDRENSDCCPDYKSFCREEKEWPPHTQPWYPEGCFKDGQHYEEGSVIKENCNSCTCSGQQWKCS
  QHVCLVRSELIEQVNKGDYGWTAQNYSQFWGMTLEDGFKFRLGTLPPSPMLLSMNEMTASLPATTDLPEFFVASY
  KWPGWTHGPLDQKNCAASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
  LVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQCSPPYRVSSNETEIMKEIMQNGPVQ
  AIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGTLRGAQGQKEKFWIAANSWGKSWGENGYFRI
  LRGVNESDIEKLIIAAWGQLTSSDEP

• Structural information:
  • Protein Domains: (59..10-)
    (/note="SMB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00350"-)
  • Interpro: IPR038765  IPR025661  IPR000668  IPR001212  IPR033164  
  • Prosite: PS00524 PS50958 PS00640
  • STRING: ENSP00000259782
• Other Databases: GeneCards:  TINAG  Malacards:  TINAG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005604	basement membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0000166	nucleotide binding	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0005604	basement membrane	IEA	cellular component
GO:0005604	basement membrane	IDA	cellular component
GO:0007155	cell adhesion	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)