• Gene id: 27258

Gene Summary

• Gene Symbol: LSM3   Gene   UCSC   Ensembl
• Aliases: SMX4, USS2, YLR438C
• Gene name: LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
• Alternate names: U6 snRNA-associated Sm-like protein LSm3, LSM3 U6 small nuclear RNA and mRNA degradation associated, LSM3 homolog, U6 small nuclear RNA associated,
• Gene location: 3p25.1 (85169511: 85676199)     Exons: 28     NC_000016.10
• Gene summary(Entrez): Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length
• OMIM: 607283

Protein Summary

• Protein general information: P62310  
  • Name: U6 snRNA associated Sm like protein LSm3
  • Length: 102  
  • Mass: 11845
• Sequence:

  MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIY
  KSTKRNIPMLFVRGDGVVLVAPPLRVG

• Structural information:
  • Interpro: IPR034105  IPR001163  IPR010920  IPR040002  
  • CDD: cd01730
  • PDB: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • PDBsum: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • DIP: 31218
  • STRING: ENSP00000302160
• Other Databases: GeneCards:  LSM3  Malacards:  LSM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990726	Lsm1-7-Pat1 complex	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0005688	U6 snRNP	IBA	cellular component
GO:0000932	P-body	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IBA	cellular component
GO:0033962	cytoplasmic mRNA processing body assembly	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0120115	Lsm2-8 complex	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0000956	nuclear-transcribed mRNA catabolic process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0030629	U6 snRNA 3'-end binding	IDA	molecular function
GO:0030629	U6 snRNA 3'-end binding	IDA	molecular function
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome
hsa03018	RNA degradation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)