• Gene id: 27257

Gene Summary

• Gene Symbol: LSM1   Gene   UCSC   Ensembl
• Aliases: CASM, YJL124C
• Gene name: LSM1 homolog, mRNA degradation associated
• Alternate names: U6 snRNA-associated Sm-like protein LSm1, LSM1 homolog, U6 small nuclear RNA associated, LSM1 mRNA degradation associated, LSM1, U6 small nuclear RNA associated, LSM1-like protein U6 small nuclear RNA associated, cancer-associated Sm protein, cancer-associated ,
• Gene location: 8p11.23 (38176729: 38163320)     Exons: 4     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Inc
• OMIM: 607281

Protein Summary

• Protein general information: O15116  
  • Name: U6 snRNA associated Sm like protein LSm1 (Cancer associated Sm like) (Small nuclear ribonuclear CaSm)
  • Length: 133  
  • Mass: 15179
• Sequence:

  MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLG
  EIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

• Structural information:
  • Interpro: IPR034104  IPR001163  IPR010920  
  • CDD: cd01728
  • DIP: 31130
  • STRING: ENSP00000310596
• Other Databases: GeneCards:  LSM1  Malacards:  LSM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000290	deadenylation-dependent decapping of nuclear-transcribed mRNA	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0016070	RNA metabolic process	IBA	biological process
GO:1990726	Lsm1-7-Pat1 complex	IBA	cellular component
GO:0000339	RNA cap binding	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000956	nuclear-transcribed mRNA catabolic process	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006397	mRNA processing	TAS	biological process
GO:0008380	RNA splicing	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0036002	pre-mRNA binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0003729	mRNA binding	IEA	molecular function
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:1990124	messenger ribonucleoprotein complex	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0071044	histone mRNA catabolic process	IMP	biological process
GO:0000375	RNA splicing, via transesterification reactions	TAS	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881