• Gene id: 27250

Gene Summary

• Gene Symbol: PDCD4   Gene   UCSC   Ensembl
• Aliases: H731
• Gene name: programmed cell death 4
• Alternate names: programmed cell death protein 4, neoplastic transformation inhibitor protein, nuclear antigen H731, programmed cell death 4 (neoplastic transformation inhibitor), protein 197/15a,
• Gene location: 10q25.2 (110871794: 110900005)     Exons: 13     NC_000010.11
• Gene summary(Entrez): This gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, De
• OMIM: 608610

Protein Summary

• Protein general information: Q53EL6  
  • Name: Programmed cell death protein 4 (Neoplastic transformation inhibitor protein) (Nuclear antigen H731 like) (Protein 197/15a)
  • Length: 469  
  • Mass: 51735
  • Tissue specificity: Up-regulated in proliferative cells. Highly expressed in epithelial cells of the mammary gland. Reduced expression in lung cancer and colon carcinoma. {ECO
• Sequence:

  MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRDSGRGD
  SVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENC
  VYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSD
  LCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
  LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLEST
  GESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR
  GRKRFVSEGDGGRLKPESY

• Structural information:
  • Protein Domains: (163..28-)
    (/note="MI-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00698-)
    (326..44-)
    (/note="MI-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00698"-)
  • Interpro: IPR016024  IPR003891  IPR016021  IPR039778  
  • Prosite: PS51366
  • PDB: 2GGF 2KZT 2RG8 2ZU6 3EIJ
  • PDBsum: 2GGF 2KZT 2RG8 2ZU6 3EIJ
  • DIP: 29756
  • STRING: ENSP00000280154
• Other Databases: GeneCards:  PDCD4  Malacards:  PDCD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0034393	positive regulation of smooth muscle cell apoptotic process	IEA	biological process
GO:1900016	negative regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:0060940	epithelial to mesenchymal transition involved in cardiac fibroblast development	IEA	biological process
GO:0051246	regulation of protein metabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1904761	negative regulation of myofibroblast differentiation	IMP	biological process
GO:1904706	negative regulation of vascular smooth muscle cell proliferation	IMP	biological process
GO:0005634	nucleus	ISS	cellular component
GO:1905064	negative regulation of vascular smooth muscle cell differentiation	IDA	biological process
GO:0030509	BMP signaling pathway	IDA	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:1905461	positive regulation of vascular associated smooth muscle cell apoptotic process	IMP	biological process
GO:0060940	epithelial to mesenchymal transition involved in cardiac fibroblast development	ISS	biological process
GO:1900016	negative regulation of cytokine production involved in inflammatory response	ISS	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:1900016	negative regulation of cytokine production involved in inflammatory response	ISS	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0007569	cell aging	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0045786	negative regulation of cell cycle	NAS	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0005737	cytoplasm	IMP	cellular component
GO:0005634	nucleus	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043508	negative regulation of JUN kinase activity	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881