• Gene id: 27242

Gene Summary

• Gene Symbol: TNFRSF21   Gene   UCSC   Ensembl
• Aliases: BM-018, CD358, DR6
• Gene name: TNF receptor superfamily member 21
• Alternate names: tumor necrosis factor receptor superfamily member 21, TNFR-related death receptor 6, death receptor 6,
• Gene location: 6p12.3 (47309909: 47231531)     Exons: 7     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the tumor necrosis factor receptor superfamily. The encoded protein activates nuclear factor kappa-B and mitogen-activated protein kinase 8 (also called c-Jun N-terminal kinase 1), and induces cell apoptosis. Through its deat
• OMIM: 602218

Protein Summary

• Protein general information: O75509  
  • Name: Tumor necrosis factor receptor superfamily member 21 (Death receptor 6) (CD antigen CD358)
  • Length: 655  
  • Mass: 71845
  • Tissue specificity: Detected in fetal spinal cord and in brain neurons, with higher levels in brain from Alzheimer disease patients (at protein level). Highly expressed in heart, brain, placenta, pancreas, lymph node, thymus and prostate. Detected at lowe
• Sequence:

  MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTY
  VSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVC
  PVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTSPSP
  GTAIFPRPEHMETHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNH
  QQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHLPWMIVLFLLLVLVVIVVCSIRKSSR
  TLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILKLVAAQVGSQWKDIYQFLCNASEREVAAFSN
  GYTADHERAYAALQHWTIRGPEASLAQLISALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPS
  PNAKLENSALLTVEPSPQDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
  DDMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL

• Structural information:
  • Protein Domains: (415..49-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR011029  IPR000488  IPR001368  IPR022330  IPR034037   IPR034034  IPR011641  
  • Prosite: PS50017 PS00652 PS50050
  • CDD: cd08778 cd10583
  • PDB: 2DBH 3QO4 3U3P 3U3Q 3U3S 3U3T 3U3V
  • PDBsum: 2DBH 3QO4 3U3P 3U3Q 3U3S 3U3T 3U3V
  • DIP: 53299
  • STRING: ENSP00000296861
• Other Databases: GeneCards:  TNFRSF21  Malacards:  TNFRSF21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006959	humoral immune response	IBA	biological process
GO:0030889	negative regulation of B cell proliferation	IBA	biological process
GO:0031642	negative regulation of myelination	IBA	biological process
GO:0042130	negative regulation of T cell proliferation	IBA	biological process
GO:0051402	neuron apoptotic process	IBA	biological process
GO:2000663	negative regulation of interleukin-5 secretion	IBA	biological process
GO:2001180	negative regulation of interleukin-10 secretion	IBA	biological process
GO:0002250	adaptive immune response	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0097252	oligodendrocyte apoptotic process	IBA	biological process
GO:2000666	negative regulation of interleukin-13 secretion	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:2001180	negative regulation of interleukin-10 secretion	ISS	biological process
GO:2000663	negative regulation of interleukin-5 secretion	ISS	biological process
GO:0051402	neuron apoptotic process	ISS	biological process
GO:0048713	regulation of oligodendrocyte differentiation	ISS	biological process
GO:0042552	myelination	ISS	biological process
GO:0042130	negative regulation of T cell proliferation	ISS	biological process
GO:0031642	negative regulation of myelination	IMP	biological process
GO:0030889	negative regulation of B cell proliferation	ISS	biological process
GO:0006959	humoral immune response	ISS	biological process
GO:0001783	B cell apoptotic process	ISS	biological process
GO:2000666	negative regulation of interleukin-13 secretion	ISS	biological process
GO:0097252	oligodendrocyte apoptotic process	ISS	biological process
GO:0050852	T cell receptor signaling pathway	ISS	biological process
GO:0031226	intrinsic component of plasma membrane	ISS	cellular component
GO:0006915	apoptotic process	IMP	biological process
GO:0002250	adaptive immune response	ISS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001180	negative regulation of interleukin-10 secretion	IEA	biological process
GO:2000663	negative regulation of interleukin-5 secretion	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0048713	regulation of oligodendrocyte differentiation	IEA	biological process
GO:0042552	myelination	IEA	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0030889	negative regulation of B cell proliferation	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0006959	humoral immune response	IEA	biological process
GO:0001783	B cell apoptotic process	IEA	biological process
GO:2000666	negative regulation of interleukin-13 secretion	IEA	biological process
GO:0097252	oligodendrocyte apoptotic process	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0031226	intrinsic component of plasma membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0007413	axonal fasciculation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray