• Gene id: 27237

Gene Summary

• Gene Symbol: ARHGEF16   Gene   UCSC   Ensembl
• Aliases: GEF16, NBR
• Gene name: Rho guanine nucleotide exchange factor 16
• Alternate names: rho guanine nucleotide exchange factor 16, Rho guanine exchange factor (GEF) 16, Rho guanine nucleotide exchange factor (GEF) 16, ephexin-4, ephexin4,
• Gene location: 1p36.32 (3454588: 3481114)     Exons: 18     NC_000001.11
• Gene summary(Entrez): Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions. [provided by RefSeq, Jul 2008]
• OMIM: 615187

Protein Summary

• Protein general information: Q5VV41  
  • Name: Rho guanine nucleotide exchange factor 16 (Ephexin 4)
  • Length: 709  
  • Mass: 80105
• Sequence:

  MAQRHSDSSLEEKLLGHRFHSELRLDAGGNPASGLPMVRGSPRVRDDAAFQPQVPAPPQPRPPGHEEPWPIVLST
  ESPAALKLGTQQLIPKSLAVASKAKTPARHQSFGAAVLSREAARRDPKLLPAPSFSLDDMDVDKDPGGMLRRNLR
  NQSYRAAMKGLGKPGGQGDAIQLSPKLQALAEEPSQPHTRSPAKNKKTLGRKRGHKGSFKDDPQLYQEIQERGLN
  TSQESDDDILDESSSPEGTQKVDATIVVKSYRPAQVTWSQLPEVVELGILDQLSTEERKRQEAMFEILTSEFSYQ
  HSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKHFHPYI
  AYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKA
  ASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPT
  CYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLL
  SSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGE
  TGWFPEDFARFITSRVAVEGNVRRMERLRVETDV

• Structural information:
  • Protein Domains: (284..46-)
    (/note="DH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00062-)
    (501..62-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (629..68-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR035797  IPR035899  IPR000219  IPR011993  IPR001849   IPR036028  IPR001452  
  • Prosite: PS50010 PS50003 PS50002
  • CDD: cd00160 cd11938
  • PDB: 1X6B
  • PDBsum: 1X6B
  • STRING: ENSP00000367629
• Other Databases: GeneCards:  ARHGEF16  Malacards:  ARHGEF16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090630	activation of GTPase activity	IBA	biological process
GO:0005089	Rho guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0005089	Rho guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0090630	activation of GTPase activity	IMP	biological process
GO:0017048	Rho GTPase binding	IPI	molecular function
GO:0017048	Rho GTPase binding	IPI	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	IMP	biological process
GO:0060326	cell chemotaxis	IMP	biological process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq