• Gene id: 27233

Gene Summary

• Gene Symbol: SULT1C4   Gene   UCSC   Ensembl
• Aliases: SULT1C, SULT1C2
• Gene name: sulfotransferase family 1C member 4
• Alternate names: sulfotransferase 1C4, ST1C4, SULT1C#2, sulfotransferase 1C2, sulfotransferase family, cytosolic, 1C, member 2, sulfotransferase family, cytosolic, 1C, member 4, sulfotransferase family, cytosolic, 1C, member C2,
• Gene location: 2q12.3 (108377953: 108388988)     Exons: 7     NC_000002.12
• Gene summary(Entrez): Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and

Protein Summary

• Protein general information: O75897  
  • Name: Sulfotransferase 1C4 (ST1C4) (EC 2.8.2. ) (Sulfotransferase 1C2) (SULT1C#2)
  • Length: 302  
  • Mass: 35520
  • Tissue specificity: Expressed at high levels in fetal lung and kidney and at low levels in fetal heart, adult kidney, ovary and spinal chord.
• Sequence:

  MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVE
  KSKRAPTHQRFPFLEMKIPSLGSGLEQAHAMPSPRILKTHLPFHLLPPSLLEKNCKIIYVARNPKDNMVSYYHFQ
  RMNKALPAPGTWEEYFETFLAGKVCWGSWHEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDK
  VLDKIVHYTSFDVMKQNPMANYSSIPAEIMDHSISPFMRKGAVGDWKKHFTVAQNERFDEDYKKKMTDTRLTFHF
  QF

• Structural information:
  • Interpro: IPR027417  IPR000863  
  • PDB: 2AD1 2GWH
  • PDBsum: 2AD1 2GWH
  • STRING: ENSP00000272452
• Other Databases: GeneCards:  SULT1C4  Malacards:  SULT1C4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0008146	sulfotransferase activity	IDA	molecular function
GO:0051923	sulfation	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006068	ethanol catabolic process	IDA	biological process
GO:0004062	aryl sulfotransferase activity	IDA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	biological process
GO:0051923	sulfation	IDA	biological process
GO:0008146	sulfotransferase activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray